PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ote100240880051
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Ocimeae; Ocimum
Family LBD
Protein Properties Length: 118aa    MW: 13859.7 Da    PI: 4.3715
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ote100240880051genomeOteDB-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF26055.12.2e-1718318100
                        DUF260  18 lapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallk 98 
                                   +apyfpa+ p++f+ +   F ++ v++ +++lp++ r++a+  ++yeA  rardP  G++ v++kl+ +l++  ael  + 
  Ote100240880051|100240880051   1 MAPYFPAQYPERFETLSTHFDVDYVVECVETLPPDCRREAVVNMFYEAYQRARDPAGGCYDVFRKLRADLQSRIAELLIVT 81 
                                   59*********************************************************************9999998776 PP

                        DUF260  99 ee 100
                                   ee
  Ote100240880051|100240880051  82 EE 83 
                                   65 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031954.6E-15177IPR004883Lateral organ boundaries, LOB
PROSITE profilePS5089113.234184IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 118 aa     Download sequence    Send to blast
MAPYFPAQYP ERFETLSTHF DVDYVVECVE TLPPDCRREA VVNMFYEAYQ RARDPAGGCY  60
DVFRKLRADL QSRIAELLIV TEEIAFQRSR FIDLKKKIDD RIDDEEPDSS IPSLQQFL