PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ote100240360101
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Ocimeae; Ocimum
Family LBD
Protein Properties Length: 136aa    MW: 15240.5 Da    PI: 8.3324
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ote100240360101genomeOteDB-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260114.56.9e-3681071100
                        DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvil 81 
                                   +CaaCk+lrr+C++dC+++p fp+++p +fa vhk++Ga nv kll++lp + r +a+++l+yeA +r++dPvyG++g i+
  Ote100240360101|100240360101   8 RCAACKHLRRRCPSDCIFSPFFPSDNPLRFASVHKIYGACNVAKLLQDLPAKWRAQAADTLCYEAYCRIKDPVYGCAGSIT 88 
                                   6******************************************************************************** PP

                        DUF260  82 klqqqleqlkaelallkee 100
                                    l++ql+ ++ +la+l+++
  Ote100240360101|100240360101  89 VLHHQLNAAEFQLATLEAQ 107
                                   *************999887 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089122.7917108IPR004883Lateral organ boundaries, LOB
PfamPF031953.2E-368105IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 136 aa     Download sequence    Send to blast
MHGMDSSRCA ACKHLRRRCP SDCIFSPFFP SDNPLRFASV HKIYGACNVA KLLQDLPAKW  60
RAQAADTLCY EAYCRIKDPV YGCAGSITVL HHQLNAAEFQ LATLEAQLQA IKNESNTVKL  120
NQHHQPTSCY TLPTLF
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011098999.11e-52PREDICTED: LOB domain-containing protein 23-like
SwissprotP594674e-43LBD23_ARATH; LOB domain-containing protein 23
TrEMBLA0A022QJ181e-47A0A022QJ18_ERYGU; Uncharacterized protein (Fragment)
STRINGPOPTR_0012s13910.18e-46(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA52772039