PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ote100235820041
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Ocimeae; Ocimum
Family LBD
Protein Properties Length: 175aa    MW: 19548.8 Da    PI: 9.1604
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ote100235820041genomeOteDB-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260109.23.1e-341084175
                        DUF260  1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyG 75
                                  +CaaCk+lrrkC ++C+++ yfp e+p+kfanvhk+FGasnv kll++l +++r+da++sl+yeAear+rdPvy 
  Ote100235820041|100235820041 10 PCAACKFLRRKCMPGCIFSAYFPPEEPQKFANVHKIFGASNVAKLLNELLPHQRDDAVNSLAYEAEARVRDPVYX 84
                                  7************************************************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089121.4039110IPR004883Lateral organ boundaries, LOB
PfamPF031953.1E-331084IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 175 aa     Download sequence    Send to blast
MASSSTYNPP CAACKFLRRK CMPGCIFSAY FPPEEPQKFA NVHKIFGASN VAKLLNELLP  60
HQRDDAVNSL AYEAEARVRD PVYXXXXXXX XXXXXXXXXX XXXXXRCSEC RLDPLRLQRY  120
AGAAAAGAGG GGIHARGASA AAGEIRELQR RKRWGRRWEI LSNNWCANFV SCSLE