PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ote100234360101
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Ocimeae; Ocimum
Family TALE
Protein Properties Length: 289aa    MW: 33082.5 Da    PI: 6.7063
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ote100234360101genomeOteDB-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox24.25.7e-082382712154
                                   HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
                      Homeobox  21 knrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                                   k +yp++e++++L +++gL+ +q+ +WF N+R +
  Ote100234360101|100234360101 238 KWPYPTEEDKARLVQETGLQLKQINNWFINQRKR 271
                                   469*****************************87 PP

2ELK28.63.1e-10192213122
                           ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                                   ELKh+L+++Y+++L+++++E++
  Ote100234360101|100234360101 192 ELKHELKNGYKEKLVDIREEIL 213
                                   9*******************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012551.7E-153882IPR005540KNOX1
PfamPF037904.5E-164180IPR005540KNOX1
SMARTSM012567.0E-2191146IPR005541KNOX2
PfamPF037916.0E-14100145IPR005541KNOX2
SMARTSM011880.001192213IPR005539ELK domain
PfamPF037892.9E-6192213IPR005539ELK domain
PROSITE profilePS512139.865192212IPR005539ELK domain
PROSITE profilePS5007111.564212275IPR001356Homeobox domain
SMARTSM003894.7E-10214279IPR001356Homeobox domain
SuperFamilySSF466892.18E-16214279IPR009057Homeodomain-like
CDDcd000863.56E-11215276No hitNo description
Gene3DG3DSA:1.10.10.603.2E-24219276IPR009057Homeodomain-like
PfamPF059204.1E-18232271IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 289 aa     Download sequence    Send to blast
MAFPIEEMEW LNSGIHRHPS SSIPAAHGDD ASAKAMDWQT KAQILSHPLF DQLLSAHVSC  60
LRIATPVDQL PRIDAQLSQS LQVLAKYSPL PHANLTLQTD LQQFMTNYVL LLCSFKEKLQ  120
QHVRIHAMEA VMGCWEIEQS LQSLTGVSPG EGTGATMSDD EDEQEDSMMD MGLGPLIPTD  180
SERSLMERVR QELKHELKNG YKEKLVDIRE EILRKRRAGK LPGDTTYVLK EWWHSHSKWP  240
YPTEEDKARL VQETGLQLKQ INNWFINQRK RNWHAHANTN PSSSQSKRK
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006345637.11e-149PREDICTED: homeobox protein knotted-1-like 3
SwissprotP480001e-145KNAT3_ARATH; Homeobox protein knotted-1-like 3
TrEMBLA0A0V0ID041e-150A0A0V0ID04_SOLCH; Putative homeobox protein knotted-1-like 3-like
STRINGPGSC0003DMT4000403511e-148(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA14322472