PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ote100229560031
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Ocimeae; Ocimum
Family TALE
Protein Properties Length: 369aa    MW: 42273.9 Da    PI: 6.2056
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ote100229560031genomeOteDB-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox291.8e-092943282155
                                   HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
                      Homeobox  21 knrypsaeereeLAkklgLterqVkvWFqNrRake 55 
                                   k +yps++e+  LA+++gL+++q+ +WF N+R ++
  Ote100229560031|100229560031 294 KWPYPSESEKVALAESTGLDQKQINNWFINQRKRH 328
                                   669*****************************885 PP

2ELK37.93.8e-13248269122
                           ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                                   ELK++LlrKYsgyL+sLkqE+s
  Ote100229560031|100229560031 248 ELKNHLLRKYSGYLSSLKQELS 269
                                   9*******************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012557.6E-22103147IPR005540KNOX1
PfamPF037902.4E-22105146IPR005540KNOX1
SMARTSM012562.0E-27154205IPR005541KNOX2
PfamPF037913.9E-23158204IPR005541KNOX2
SMARTSM011883.5E-7248269IPR005539ELK domain
PROSITE profilePS5121311.296248268IPR005539ELK domain
PfamPF037892.6E-10248269IPR005539ELK domain
PROSITE profilePS5007112.957268331IPR001356Homeobox domain
SuperFamilySSF466891.33E-19269344IPR009057Homeodomain-like
SMARTSM003892.8E-13270335IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.601.7E-27273334IPR009057Homeodomain-like
CDDcd000869.94E-12280332No hitNo description
PfamPF059201.1E-16288327IPR008422Homeobox KN domain
PROSITE patternPS000270306329IPR017970Homeobox, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0001708Biological Processcell fate specification
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010051Biological Processxylem and phloem pattern formation
GO:0010089Biological Processxylem development
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 369 aa     Download sequence    Send to blast
MEDYNHEMSE NSNSRCNFLY GGSVLEAAGS NSVYGRSSFH LQSGNCYDQS ENQTVKSESA  60
GAAQDHASRF QFTAISRGYL TAAEDHRRRH DRRQESHDSG EAESIKARII AHPQYSNLLD  120
AYMDCQKVGA PPEVVARLTA VRQELEASQR GAAAARDVTK DPELDQFMEA YYDMLVKYRE  180
ELTKPIHEAM EFMRRVEKQL NLLTNSPLRI FNSNSEEKYE GGSSEDEQEN SGGETEVPEI  240
DPRAEDRELK NHLLRKYSGY LSSLKQELSK KKKKGKLPKD ARQKLLSWWE LHYKWPYPSE  300
SEKVALAEST GLDQKQINNW FINQRKRHWK PSEDMQFMVM DGMHPQNAAA AALYMEGHYM  360
GEGPYRLGP
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00675ChIP-seqTransfer from GRMZM2G017087Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011074319.10.0PREDICTED: homeotic protein knotted-1
SwissprotQ413301e-171KN1_SOLLC; Homeotic protein knotted-1
TrEMBLV9LXK80.0V9LXK8_TOBAC; Knotted 1
STRINGVIT_18s0001g08380.t011e-176(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA49732333