PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ote100228250221
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Ocimeae; Ocimum
Family NAC
Protein Properties Length: 233aa    MW: 27047 Da    PI: 5.3814
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ote100228250221genomeOteDB-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM169.11.4e-5261231128
                           NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksg 81 
                                   lppGfrFhPtdeelv++yLk+k++g ++el ++i+evd+yk+ePw+L         ewyfF +rd+ky++g r+nrat++g
  Ote100228250221|100228250221   6 LPPGFRFHPTDEELVNYYLKRKIQGLEIEL-DIIPEVDLYKCEPWELA--------EWYFFGPRDRKYPNGFRTNRATRAG 77 
                                   79****************************.99**************5........8************************ PP

                           NAM  82 yWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                                   yWk+tgkd++v s +++++g+kktLv+y+grap+g +tdWvmheyrl
  Ote100228250221|100228250221  78 YWKSTGKDRRVSS-QNRAIGMKKTLVYYRGRAPQGIRTDWVMHEYRL 123
                                   ************9.8999***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.57E-604147IPR003441NAC domain
PROSITE profilePS5100555.5166146IPR003441NAC domain
PfamPF023654.6E-307123IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 233 aa     Download sequence    Send to blast
MAPVGLPPGF RFHPTDEELV NYYLKRKIQG LEIELDIIPE VDLYKCEPWE LAEWYFFGPR  60
DRKYPNGFRT NRATRAGYWK STGKDRRVSS QNRAIGMKKT LVYYRGRAPQ GIRTDWVMHE  120
YRLDDKEWED TSGIQDSYAL CRVFKKNGLC SEVEELGQSS SIPLLDHYMQ GVSNEHETMS  180
PDFPLASSST ICMXXXXXXX XXXSWMQFIT DDVWCSSTQA FGGEEMSHMG FTN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A7e-53114712166NO APICAL MERISTEM PROTEIN
1ut4_B7e-53114712166NO APICAL MERISTEM PROTEIN
1ut7_A7e-53114712166NO APICAL MERISTEM PROTEIN
1ut7_B7e-53114712166NO APICAL MERISTEM PROTEIN
4dul_A7e-53114712166NAC domain-containing protein 19
4dul_B7e-53114712166NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor directing sieve element enucleation and cytosol degradation. Not required for formation of lytic vacuoles. Regulates, with NAC086, the transcription of NEN1, NEN2, NEN3, NEN4, RTM1, RTM2, UBP16, PLDZETA, ABCB10 and At1g26450. {ECO:0000269|PubMed:25081480}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00363DAPTransfer from AT3G17730Download
Motif logo
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Regulated by the transcription factor APL (AC Q9SAK5). {ECO:0000269|PubMed:25081480}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012855689.11e-145PREDICTED: NAC domain-containing protein 86 isoform X2
SwissprotA4VCM03e-80NAC45_ARATH; NAC domain-containing protein 45
TrEMBLA0A068TRH51e-131A0A068TRH5_COFCA; Uncharacterized protein
STRINGMigut.O00243.1.p1e-143(Erythranthe guttata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA46212442
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]