PlantTFDB
Plant Transcription Factor Database
PlantRegMap/PlantTFDB v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ote100226640082
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Ocimeae; Ocimum
Family bZIP
Protein Properties Length: 360aa    MW: 38002 Da    PI: 7.6874
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ote100226640082genomeOteDB-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_165.68.6e-21268330163
                                   XXXXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                        bZIP_1   1 ekelkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                                   e+elkr+rrkq+NRe+ArrsR+RK+ae++eL++++++L++eN +L+ e+ ++k e+++l +++
  Ote100226640082|100226640082 268 ERELKRQRRKQSNRESARRSRLRKQAECDELAQRADSLKEENASLRAEMARIKSEYDQLVAQN 330
                                   89********************************************************98776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF077771.2E-11258IPR012900G-box binding protein, multifunctional mosaic region
PfamPF165961.4E-4299235No hitNo description
Gene3DG3DSA:1.20.5.1702.4E-18261329No hitNo description
PfamPF001709.6E-19268330IPR004827Basic-leucine zipper domain
SMARTSM003383.0E-21268332IPR004827Basic-leucine zipper domain
PROSITE profilePS5021713.059270333IPR004827Basic-leucine zipper domain
SuperFamilySSF579599.38E-11271327No hitNo description
CDDcd147021.87E-23273324No hitNo description
PROSITE patternPS000360275290IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 360 aa     Download sequence    Send to blast
MPPPGFLASS PQAHPYMWGV QWHAYSCSLQ QFVPPYGTPP HPYVAMYPHG GIYAHPTMAP  60
GSYPFSPFAM PSPNSIAEAS VSIPGNAEAD GKSSEGKGKL PIKRSKGSLG SLNMITGKND  120
EPGKTSGATE NGMHPKSGET ASEGSSEGSD ANSHNDSEGK SSGRPDSTEP PQSGSAPNNS  180
QNGGHGTSHA MASPSMAMVP IPAPAVGAVS GVPGPTTNLN IGMDYWGAAP SSGMPAMRGK  240
VPAAPVAGGI VSTGSRDNIQ SQLWIQDERE LKRQRRKQSN RESARRSRLR KQAECDELAQ  300
RADSLKEENA SLRAEMARIK SEYDQLVAQN ASLKERLGEV SGPEDPRCSR DEQRASNKDA
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator that binds to the G-box motif (5'-CACGTG-3') and other cis-acting elements with 5'-ACGT-3' core, such as Hex, C-box and as-1 motifs. Possesses high binding affinity to G-box, much lower affinity to Hex and C-box, and little affinity to as-1 element (PubMed:18315949). G-box and G-box-like motifs are cis-acting elements defined in promoters of certain plant genes which are regulated by such diverse stimuli as light-induction or hormone control (Probable). Binds to the G-box motif 5'-CACGTG-3' of LHCB2.4 (At3g27690) promoter. May act as transcriptional repressor in light-regulated expression of LHCB2.4. Binds DNA as monomer. DNA-binding activity is redox-dependent (PubMed:22718771). {ECO:0000269|PubMed:18315949, ECO:0000269|PubMed:22718771, ECO:0000305|PubMed:18315949}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011082307.10.0bZIP transcription factor 16-like isoform X1
RefseqXP_011082308.10.0bZIP transcription factor 16-like isoform X1
RefseqXP_011082309.10.0bZIP transcription factor 16-like isoform X1
RefseqXP_011082310.10.0bZIP transcription factor 16-like isoform X2
RefseqXP_020550561.10.0bZIP transcription factor 16-like isoform X2
RefseqXP_020550562.10.0bZIP transcription factor 16-like isoform X2
SwissprotQ501B21e-133BZP16_ARATH; bZIP transcription factor 16
TrEMBLA0A4D8Y7P40.0A0A4D8Y7P4_SALSN; Plant G-box-binding factor
STRINGXP_008238155.11e-179(Prunus mume)
STRINGEMJ104011e-179(Prunus persica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA30652446
Publications ? help Back to Top
  1. Ezer D, et al.
    The G-Box Transcriptional Regulatory Code in Arabidopsis.
    Plant Physiol., 2017. 175(2): p. 628-640
    [PMID:28864470]