PlantTFDB
Plant Transcription Factor Database
PlantRegMap/PlantTFDB v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ote100226640081
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Ocimeae; Ocimum
Family bZIP
Protein Properties Length: 407aa    MW: 43001.4 Da    PI: 7.0201
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ote100226640081genomeOteDB-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_165.41e-20315377163
                                   XXXXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                        bZIP_1   1 ekelkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                                   e+elkr+rrkq+NRe+ArrsR+RK+ae++eL++++++L++eN +L+ e+ ++k e+++l +++
  Ote100226640081|100226640081 315 ERELKRQRRKQSNRESARRSRLRKQAECDELAQRADSLKEENASLRAEMARIKSEYDQLVAQN 377
                                   89********************************************************98776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF077778.3E-211105IPR012900G-box binding protein, multifunctional mosaic region
PfamPF165961.8E-42146282No hitNo description
Gene3DG3DSA:1.20.5.1702.0E-18308376No hitNo description
SMARTSM003383.0E-21315379IPR004827Basic-leucine zipper domain
PfamPF001701.1E-18315377IPR004827Basic-leucine zipper domain
PROSITE profilePS5021713.059317380IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.13E-10318374No hitNo description
CDDcd147022.35E-23320371No hitNo description
PROSITE patternPS000360322337IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 407 aa     Download sequence    Send to blast
MSSSEVDKTS KEGKEPKEPK TPSAQEQTST ASGVVPAEWS GFQTYSPMPP PGFLASSPQA  60
HPYMWGVQWH AYSCSLQQFV PPYGTPPHPY VAMYPHGGIY AHPTMAPGSY PFSPFAMPSP  120
NSIAEASVSI PGNAEADGKS SEGKGKLPIK RSKGSLGSLN MITGKNDEPG KTSGATENGM  180
HPKSGETASE GSSEGSDANS HNDSEGKSSG RPDSTEPPQS GSAPNNSQNG GHGTSHAMAS  240
PSMAMVPIPA PAVGAVSGVP GPTTNLNIGM DYWGAAPSSG MPAMRGKVPA APVAGGIVST  300
GSRDNIQSQL WIQDERELKR QRRKQSNRES ARRSRLRKQA ECDELAQRAD SLKEENASLR  360
AEMARIKSEY DQLVAQNASL KERLGEVSGP EDPRCSRDEQ RASNKDA
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator that binds to the G-box motif (5'-CACGTG-3') and other cis-acting elements with 5'-ACGT-3' core, such as Hex, C-box and as-1 motifs. Possesses high binding affinity to G-box, much lower affinity to Hex and C-box, and little affinity to as-1 element (PubMed:18315949). G-box and G-box-like motifs are cis-acting elements defined in promoters of certain plant genes which are regulated by such diverse stimuli as light-induction or hormone control (Probable). Binds to the G-box motif 5'-CACGTG-3' of LHCB2.4 (At3g27690) promoter. May act as transcriptional repressor in light-regulated expression of LHCB2.4. Binds DNA as monomer. DNA-binding activity is redox-dependent (PubMed:22718771). {ECO:0000269|PubMed:18315949, ECO:0000269|PubMed:22718771, ECO:0000305|PubMed:18315949}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00291DAPTransfer from AT2G35530Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011082310.10.0bZIP transcription factor 16-like isoform X2
RefseqXP_020550561.10.0bZIP transcription factor 16-like isoform X2
RefseqXP_020550562.10.0bZIP transcription factor 16-like isoform X2
SwissprotQ501B21e-145BZP16_ARATH; bZIP transcription factor 16
TrEMBLA0A4D8Y7P40.0A0A4D8Y7P4_SALSN; Plant G-box-binding factor
STRINGEMJ104010.0(Prunus persica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA30652446
Publications ? help Back to Top
  1. Ezer D, et al.
    The G-Box Transcriptional Regulatory Code in Arabidopsis.
    Plant Physiol., 2017. 175(2): p. 628-640
    [PMID:28864470]