PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ote100226380181
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Ocimeae; Ocimum
Family G2-like
Protein Properties Length: 378aa    MW: 42487.4 Da    PI: 10.1651
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ote100226380181genomeOteDB-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like986.6e-3189142255
                       G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                                   prlrWtp+LH +Fv+a+++LGG+ +AtPk++l+lm+v gL+++hvkSHLQ+YR+
  Ote100226380181|100226380181  89 PRLRWTPDLHLSFVHAIQRLGGQGRATPKAVLQLMNVRGLSISHVKSHLQMYRS 142
                                   8****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.5E-2885143IPR009057Homeodomain-like
PROSITE profilePS512949.3785145IPR017930Myb domain
SuperFamilySSF466891.59E-1487143IPR009057Homeodomain-like
TIGRFAMsTIGR015578.5E-2389144IPR006447Myb domain, plants
PfamPF002492.3E-890141IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 378 aa     Download sequence    Send to blast
MSNDQIIRQS SLGKRMDDII SAEADNTLSS SSENSSSIDL NEDAVSGVVG DLMNETSSIS  60
IQRKEQGDEG KEKSKNNSSV RQYVRSKMPR LRWTPDLHLS FVHAIQRLGG QGRATPKAVL  120
QLMNVRGLSI SHVKSHLQMY RSKKLDESGR VIGQSNSLYI QGRGYVYDKC SSPFHELRVE  180
NGGIVLARKS NPSSPFPQTL KSHHPYQINT LSSRYHPWSS LYRHEPNILS NRTHALHESY  240
SNGPIRPAQF LEGRRWPPRE FIQNQKEISK SNNVWSSNEN LRQQSRWDSG FINQQKSSFV  300
ASHNSKPFIN LDNPLRLQMK EKGNFNHTEW FPSDLKLSLS IGLSNNNVQK SCCNDDGGGG  360
INTKLSLALT PHSSSTAT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4r_A2e-1790144357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B2e-1790144357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C2e-1790144357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D2e-1790144357Protein PHOSPHATE STARVATION RESPONSE 1
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011101395.11e-115myb-related protein 2
RefseqXP_020546992.11e-115myb-related protein 2
TrEMBLA0A4D9B0P71e-125A0A4D9B0P7_SALSN; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA55162334