PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ote100223480081
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Ocimeae; Ocimum
Family LBD
Protein Properties Length: 115aa    MW: 12499.9 Da    PI: 4.7782
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ote100223480081genomeOteDB-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF26044.64.3e-14196455100
                        DUF260  55 edamsslvyeAearardPvyGavgvilklqqqleqlkaelallkee 100
                                    +a++sl+yeAear++dPvyG+vg i+ lq+q+ +l++el++++++
  Ote100223480081|100223480081  19 IHAVNSLAYEAEARLKDPVYGCVGAISVLQRQVFNLQKELDATNAN 64 
                                   5799************************************998875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS508919.306165IPR004883Lateral organ boundaries, LOB
PfamPF031955.0E-121962IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 115 aa     Download sequence    Send to blast
MSAWLHIRAI FSAGGADEIH AVNSLAYEAE ARLKDPVYGC VGAISVLQRQ VFNLQKELDA  60
TNANIMRFAG GNGPPFSDDP NQPRRDPEYG SGLSDPNAGY SLPYYWPRKG EDGGI
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012850821.18e-33PREDICTED: protein LATERAL ORGAN BOUNDARIES
SwissprotQ8L8Q31e-24LBD25_ARATH; LOB domain-containing protein 25
TrEMBLA0A022R7871e-24A0A022R787_ERYGU; Uncharacterized protein
STRINGPGSC0003DMT4000178053e-23(Solanum tuberosum)