PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ote100221370201
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Ocimeae; Ocimum
Family TCP
Protein Properties Length: 322aa    MW: 35658 Da    PI: 10.1284
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ote100221370201genomeOteDB-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP133.51.9e-41782072134
                           TCP   2 agkkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssaseceaesssssa 82 
                                   ++kkdrhski T++g+RdRRvRls+++a++fFdLq++LGfdk+skt++WLl+++k+aikel++++++ +  + +++ sss+
  Ote100221370201|100221370201  78 TAKKDRHSKINTAQGPRDRRVRLSINIARKFFDLQEMLGFDKPSKTLDWLLTKSKAAIKELVQSKQNGS-GSGNGNGSSSS 157
                                   78**************************************************************77766.33222222222 PP

                           TCP  83 snsssgkaaksaakskksqksaasalnlakesrakarararertrekmrikn 134
                                   s  ++g+ ++ ++ +k++q+ a++al++ake            t ekm+ k+
  Ote100221370201|100221370201 158 S--ENGADSRRKHGGKDKQTAASAALSPAKEXXXXXXXXXXXXTLEKMCFKQ 207
                                   2..2335555566677777777778********999999999*******984 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF036345.7E-3878172IPR005333Transcription factor, TCP
PROSITE profilePS5136936.91280138IPR017887Transcription factor TCP subgroup
Sequence ? help Back to Top
Protein Sequence    Length: 322 aa     Download sequence    Send to blast
MLGRNTYLVP SSHHNLXXXX XXXXXXXXXX XXXXXXXXXX EEVFPSGFYL APALDNATFF  60
NQENGNPSLA AGFHRKPTAK KDRHSKINTA QGPRDRRVRL SINIARKFFD LQEMLGFDKP  120
SKTLDWLLTK SKAAIKELVQ SKQNGSGSGN GNGSSSSSEN GADSRRKHGG KDKQTAASAA  180
LSPAKEXXXX XXXXXXXXTL EKMCFKQLNG GGENHNQVDF LQLSAGSCSR NVKMSGGFCE  240
QINNPHCFLR NEGVNQGLID EPVVIKKKSK NPFFGFQQNL VLNSNSMAPS ANENWDVFGF  300
ASQSNLHAIL DHHKFINSNS NI
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00215DAPTransfer from AT1G67260Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011099310.13e-64PREDICTED: transcription factor CYCLOIDEA
TrEMBLA0A096ZGF85e-80A0A096ZGF8_OCIBA; TCP transcription factor (Fragment)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA43332244