PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ote100220900051
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Ocimeae; Ocimum
Family LBD
Protein Properties Length: 168aa    MW: 18163.3 Da    PI: 7.208
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ote100220900051genomeOteDB-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF26084.41.6e-26768162
                        DUF260  1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslv 62
                                  +CaaCk lrrkC+++Cv+apyfp ++p+kf nvhk+FGasnv+kll++l+  +reda++sl+
  Ote100220900051|100220900051  7 PCAACKCLRRKCTQECVFAPYFPPDNPQKFTNVHKVFGASNVSKLLNELNAAQREDAVNSLA 68
                                  7***********************************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089117.26141IPR004883Lateral organ boundaries, LOB
PfamPF031952.2E-26768IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 168 aa     Download sequence    Send to blast
MSSSNSPCAA CKCLRRKCTQ ECVFAPYFPP DNPQKFTNVH KVFGASNVSK LLNELNAAQR  60
EDAVNSLAXX XXXXXXXXXX XXXXXXXXXX XXXXXXXXXX XXXXSASRFG GGQEGVGHVY  120
WTIGDVANNQ SPGFRAATFQ LWSPALSDGA IQCAADDGAA DGNTARGP