PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ote100217380041
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Ocimeae; Ocimum
Family TCP
Protein Properties Length: 88aa    MW: 9717.13 Da    PI: 10.3775
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ote100217380041genomeOteDB-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP109.93.7e-342486365
                           TCP  3 gkkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgt 65
                                  g+kdrhsk++T++g+RdRRvRl a++a++f+d+qd+LG+d++sk+++WL+++a++ai+el+++
  Ote100217380041|100217380041 24 GRKDRHSKVCTAKGPRDRRVRLAAQTAIQFYDVQDRLGYDRPSKAVDWLIKKAQAAIDELAQL 86
                                  89**********************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF036341.3E-312485IPR005333Transcription factor, TCP
PROSITE profilePS5136932.5452583IPR017887Transcription factor TCP subgroup
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009793Biological Processembryo development ending in seed dormancy
GO:0009965Biological Processleaf morphogenesis
GO:0030154Biological Processcell differentiation
GO:0045962Biological Processpositive regulation of development, heterochronic
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 88 aa     Download sequence    Send to blast
MAGGRSSMGE IVEVEGGHIV RSIGRKDRHS KVCTAKGPRD RRVRLAAQTA IQFYDVQDRL  60
GYDRPSKAVD WLIKKAQAAI DELAQLPA
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00062PBMTransfer from AT3G15030Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010915588.15e-48PREDICTED: transcription factor PCF5-like
RefseqXP_010915589.15e-48PREDICTED: transcription factor PCF5-like
RefseqXP_010915590.15e-48PREDICTED: transcription factor PCF5-like
RefseqXP_010915591.15e-48PREDICTED: transcription factor PCF5-like
SwissprotQ8LPR52e-45TCP4_ARATH; Transcription factor TCP4
TrEMBLA0A0M3TGE66e-48A0A0M3TGE6_9LAMI; TCP transcription factor CIN2B
TrEMBLS8DSZ81e-49S8DSZ8_9LAMI; Uncharacterized protein (Fragment)
STRINGVIT_19s0014g01680.t012e-46(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA66072234