PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ote100214180031
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Ocimeae; Ocimum
Family LBD
Protein Properties Length: 89aa    MW: 9904.19 Da    PI: 8.4877
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ote100214180031genomeOteDB-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF26024.47.9e-0813269100
                        DUF260  69 ardPvyGavgvilklqqqleqlkaelallkee 100
                                   +rdPvyG+vg i+ lqqq++ l+++lal+++e
  Ote100214180031|100214180031   1 MRDPVYGCVGAISYLQQQIDGLRQQLALTQAE 32 
                                   69**************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031952.8E-5230IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 89 aa     Download sequence    Send to blast
MRDPVYGCVG AISYLQQQID GLRQQLALTQ AEMLQLKVRQ TVSRPATSPS SSSSQLSSYT  60
LLSHSKPSNF DMDMVVEQAS FRQSMWSST
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012452830.13e-26PREDICTED: LOB domain-containing protein 4 isoform X1
TrEMBLA0A0D2UE353e-26A0A0D2UE35_G
STRINGVIT_00s0125g00290.t012e-21(Vitis vinifera)
STRINGGLYMA07G35000.11e-21(Glycine max)