PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ote100209170051
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Ocimeae; Ocimum
Family LBD
Protein Properties Length: 185aa    MW: 20006.8 Da    PI: 8.5888
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ote100209170051genomeOteDB-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260132.32e-41151141100
                        DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvil 81 
                                   +CaaCk+lrr+Ca++C+++pyf  ++p+kfa+vh++FGasnv+k+l ++ e +r da++slvyeA++r+rdP+yG++g i+
  Ote100209170051|100209170051  15 PCAACKLLRRRCAEECPFSPYFSPHEPHKFAAVHRVFGASNVSKMLMEVAEPQRADAANSLVYEANVRLRDPIYGCMGAIT 95 
                                   7******************************************************************************** PP

                        DUF260  82 klqqqleqlkaelallkee 100
                                   +lq+q+++l+ael+++++e
  Ote100209170051|100209170051  96 TLQHQIKTLQAELNAVRAE 114
                                   ***************9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.67114115IPR004883Lateral organ boundaries, LOB
PfamPF031952.9E-4115112IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 185 aa     Download sequence    Send to blast
MGRRNVFGSL NTSTPCAACK LLRRRCAEEC PFSPYFSPHE PHKFAAVHRV FGASNVSKML  60
MEVAEPQRAD AANSLVYEAN VRLRDPIYGC MGAITTLQHQ IKTLQAELNA VRAEIVRYKY  120
RDAANSIIAS TNAAVAVSVA EQPQAPPTPP AIVVSAASSA PCLYTSPSST ASYSSISNNH  180
MPFFD
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012839914.19e-92PREDICTED: LOB domain-containing protein 15
SwissprotQ9AT613e-69LBD13_ARATH; LOB domain-containing protein 13
TrEMBLA0A022S0331e-91A0A022S033_ERYGU; Uncharacterized protein
STRINGSolyc06g007390.2.14e-83(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA4324669