PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ote100203900141
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Ocimeae; Ocimum
Family LBD
Protein Properties Length: 196aa    MW: 21414.6 Da    PI: 5.6975
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ote100203900141genomeOteDB-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260138.52.4e-43401391100
                        DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvil 81 
                                   +CaaCk+lrr+C+++Cvlapyfp ++p kf ++h++FGasn++kll++lpe++r+da++s+vyeA+ar+rdPvyG++g i 
  Ote100203900141|100203900141  40 PCAACKILRRRCVEKCVLAPYFPPTEPLKFTIAHRVFGASNIIKLLQELPEDQRPDAVNSMVYEANARLRDPVYGCAGAIC 120
                                   7******************************************************************************** PP

                        DUF260  82 klqqqleqlkaelallkee 100
                                   +lq+q+++l+aela++++e
  Ote100203900141|100203900141 121 HLQKQINELQAELAKAQAE 139
                                   ***************9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.65339140IPR004883Lateral organ boundaries, LOB
PfamPF031953.7E-4340137IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005739Cellular Componentmitochondrion
Sequence ? help Back to Top
Protein Sequence    Length: 196 aa     Download sequence    Send to blast
MGYNGNTTAG AAAAAAEALS PTTPLSPPAS PPSPRVILSP CAACKILRRR CVEKCVLAPY  60
FPPTEPLKFT IAHRVFGASN IIKLLQELPE DQRPDAVNSM VYEANARLRD PVYGCAGAIC  120
HLQKQINELQ AELAKAQAEI LNIQCQNTNL IELICKQMTA KNNEDNLQQQ SMSFHENSGF  180
LLDENILGVA WDPLWT
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012834486.11e-87PREDICTED: LOB domain-containing protein 1-like
SwissprotQ9LQR04e-78LBD1_ARATH; LOB domain-containing protein 1
TrEMBLA0A022RH941e-89A0A022RH94_ERYGU; Uncharacterized protein
STRINGSolyc05g048740.2.13e-81(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA4324669