PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ote100202530081
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Ocimeae; Ocimum
Family WOX
Protein Properties Length: 205aa    MW: 23807.6 Da    PI: 8.8862
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ote100202530081genomeOteDB-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox66.92.7e-211372357
                                  --SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
                      Homeobox  3 kRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57
                                  +R+++tkeq++ Le+l+++  r+p+ae++++++++l    +++ ++V++WFqN++a++++
  Ote100202530081|100202530081 13 SRWNPTKEQINMLESLYKQgLRTPTAEQIQQITARLrdfgHIEGKNVFYWFQNHKARQRQ 72
                                  6*****************99**************************************97 PP

2Wus_type_Homeobox115.72.3e-371374465
             Wus_type_Homeobox  4 tRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqkq 65
                                  +RW+Pt+eQi++Le+lyk+GlrtP++e+iq+ita+L+ +G+ie+kNVfyWFQN+kaR+rqkq
  Ote100202530081|100202530081 13 SRWNPTKEQINMLESLYKQGLRTPTAEQIQQITARLRDFGHIEGKNVFYWFQNHKARQRQKQ 74
                                  8***********************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466899.41E-14981IPR009057Homeodomain-like
SMARTSM003898.5E-51077IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.601.0E-81372IPR009057Homeodomain-like
PfamPF000465.8E-191372IPR001356Homeobox domain
CDDcd000862.58E-61474No hitNo description
PROSITE profilePS5007110.7541873IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008284Biological Processpositive regulation of cell proliferation
GO:0009942Biological Processlongitudinal axis specification
GO:0010654Biological Processapical cell fate commitment
GO:0048825Biological Processcotyledon development
GO:0080167Biological Processresponse to karrikin
GO:0090451Biological Processcotyledon boundary formation
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 205 aa     Download sequence    Send to blast
MEGGDQTLGN GGSRWNPTKE QINMLESLYK QGLRTPTAEQ IQQITARLRD FGHIEGKNVF  60
YWFQNHKARQ RQKQKQESFA FYNRFLHASP VFSPYQKVVC SPCYIPPLKN DQVFYHQQAK  120
VPLPTASCSF KRSRMTPERS DPTRYNTNMH SFSTPRNSSI HHQETLDLFP IHPTGVVQQQ  180
TDDDIKNPNF GDADDRPFFD FFCGN
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011077272.13e-82WUSCHEL-related homeobox 2
TrEMBLA0A4D9BTG53e-85A0A4D9BTG5_SALSN; Uncharacterized protein
STRINGMigut.F01969.1.p1e-67(Erythranthe guttata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA114141925