PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ote100202020041
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Ocimeae; Ocimum
Family LBD
Protein Properties Length: 90aa    MW: 10226.6 Da    PI: 4.4334
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ote100202020041genomeOteDB-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF26039.51.6e-1214061100
                        DUF260  61 lvyeAearardPvyGavgvilklqqqleqlkaelallkee 100
                                   +vyeA ar+r+PvyG++g i +lq+q+++l+++la++++e
  Ote100202020041|100202020041   1 MVYEASARMREPVYGCAGAICQLQKQVNELQEQLAKAQAE 40 
                                   69**********************************9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031952.0E-10138IPR004883Lateral organ boundaries, LOB
PROSITE profilePS508919.466141IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 90 aa     Download sequence    Send to blast
MVYEASARMR EPVYGCAGAI CQLQKQVNEL QEQLAKAQAE LVNLQCQNAN LMALICMEMS  60
SQSLLLQNHD IHQHFPDQTT SFLDEQSLWT
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016548470.13e-33PREDICTED: LOB domain-containing protein 1-like
RefseqXP_012838343.14e-33PREDICTED: LOB domain-containing protein 1-like
SwissprotQ9LQR03e-21LBD1_ARATH; LOB domain-containing protein 1
TrEMBLA0A022RB964e-33A0A022RB96_ERYGU; Uncharacterized protein
STRINGPOPTR_0008s04350.18e-30(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA4324669