PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ote100192480011
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Ocimeae; Ocimum
Family NAC
Protein Properties Length: 246aa    MW: 27288.7 Da    PI: 9.599
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ote100192480011genomeOteDB-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM101.79.9e-32128554128
                           NAM  54 eekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                                   +ekewyfFs+rd+ky++g+r+nr++ sgyWkatg+dk +++ +g++vg+kk Lvfy g+apkg+kt+W+mheyrl
  Ote100192480011|100192480011  12 GEKEWYFFSPRDRKYPNGSRPNRVAGSGYWKATGTDKIITT-EGRKVGIKKALVFYIGKAPKGTKTNWIMHEYRL 85 
                                   689**********************************9999.999****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5100541.851108IPR003441NAC domain
SuperFamilySSF1019412.75E-428109IPR003441NAC domain
PfamPF023654.7E-151585IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009414Biological Processresponse to water deprivation
GO:0009737Biological Processresponse to abscisic acid
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 246 aa     Download sequence    Send to blast
MDFCGADKAL FGEKEWYFFS PRDRKYPNGS RPNRVAGSGY WKATGTDKII TTEGRKVGIK  60
KALVFYIGKA PKGTKTNWIM HEYRLSESPR KSGSSKLDDW VLCRIYKKNS SGQDRAAMGG  120
VQRKEYSHDS SSSSSSQYDD KLNLQRLNSA NFDWATLAGL NPVWPELIQA QQQTSVVQND  180
AYAPAGDVMD EVHSGSANQR VANSGFLPHH VTGGSLDPFS XXXXXXXTRI RMAGSGLGNE  240
KTDVFD
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swm_A3e-66711367173NAC domain-containing protein 19
3swm_B3e-66711367173NAC domain-containing protein 19
3swm_C3e-66711367173NAC domain-containing protein 19
3swm_D3e-66711367173NAC domain-containing protein 19
3swp_A3e-66711367173NAC domain-containing protein 19
3swp_B3e-66711367173NAC domain-containing protein 19
3swp_C3e-66711367173NAC domain-containing protein 19
3swp_D3e-66711367173NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that acts downstream of MYC2 in the jasmonate-mediated response to Botrytis cinerea infection (PubMed:28733419). With MYC2 forms a transcription module that regulates wounding-responsive genes (PubMed:28733419). Involved in jasmonate- and coronatine-mediated stomatal reopening in response to Pseudomonas syringae pv tomato DC3000 infection (PubMed:25005917). Regulates the expression of threonine deaminase 2 (TD2) through promoter binding (PubMed:28733419). {ECO:0000269|PubMed:25005917, ECO:0000269|PubMed:28733419}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by jasmonate (JA) (PubMed:25005917, PubMed:28733419, PubMed:30610166). Induced by wounding (PubMed:28733419, PubMed:25005917). Induced by infection with the fungal pathogen Botrytis cinerea (PubMed:28733419). Induced by coronatine (PubMed:25005917). {ECO:0000269|PubMed:25005917, ECO:0000269|PubMed:28733419, ECO:0000269|PubMed:30610166}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011098342.17e-92NAC domain-containing protein 72
SwissprotA0A3Q7HH641e-78JA2L_SOLLC; NAC domain-containing protein JA2L
TrEMBLA0A4D8YKK04e-92A0A4D8YKK0_SALSN; Uncharacterized protein
STRINGMigut.M00863.1.p7e-87(Erythranthe guttata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA31222452
Publications ? help Back to Top
  1. Tomato Genome Consortium
    The tomato genome sequence provides insights into fleshy fruit evolution.
    Nature, 2012. 485(7400): p. 635-41
    [PMID:22660326]
  2. Du M, et al.
    MYC2 Orchestrates a Hierarchical Transcriptional Cascade That Regulates Jasmonate-Mediated Plant Immunity in Tomato.
    Plant Cell, 2017. 29(8): p. 1883-1906
    [PMID:28733419]
  3. Liu Y, et al.
    MYC2 Regulates the Termination of Jasmonate Signaling via an Autoregulatory Negative Feedback Loop.
    Plant Cell, 2019. 31(1): p. 106-127
    [PMID:30610166]