PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ote100191260081
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Ocimeae; Ocimum
Family LBD
Protein Properties Length: 81aa    MW: 9061.61 Da    PI: 8.3354
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ote100191260081genomeOteDB-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF26098.85.3e-311080168
                        DUF260  1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFG...asnvlkllkalpeeeredamsslvyeAear 68
                                  +CaaCk+lrrkC ++Cv+apyfp +qp+kfanvhk+FG   asnv+kll++l++++reda++sl+yeA++r
  Ote100191260081|100191260081 10 PCAACKFLRRKCLPECVFAPYFPPDQPQKFANVHKVFGxxxASNVTKLLNELQPHQREDAVNSLAYEADMR 80
                                  7*************************************66669**************************99 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089120.411981IPR004883Lateral organ boundaries, LOB
PfamPF031955.6E-301080IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 81 aa     Download sequence    Send to blast
MSSSSSSTSP CAACKFLRRK CLPECVFAPY FPPDQPQKFA NVHKVFGXXX ASNVTKLLNE  60
LQPHQREDAV NSLAYEADMR L
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012834587.12e-46PREDICTED: LOB domain-containing protein 6
SwissprotO044793e-45LBD6_ARATH; LOB domain-containing protein 6
TrEMBLS8CFN24e-47S8CFN2_9LAMI; Uncharacterized protein
STRINGVIT_00s0340g00090.t015e-44(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA4324669