PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ote100190400061
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Ocimeae; Ocimum
Family TALE
Protein Properties Length: 476aa    MW: 51778.6 Da    PI: 8.9035
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ote100190400061genomeOteDB-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.52.5e-092132501954
                                   HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
                      Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                                   Fe   ++yp+ +++  LAk++gLt +qV++WF N R +
  Ote100190400061|100190400061 213 FEHflHPYPKDSDKLMLAKQTGLTRSQVSNWFINARVR 250
                                   664459******************************87 PP

2BELL113.11.5e-3677148172
                          BELL   1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                                   erqe+q+kkakL+++l+eV++rY+qy++q+q+vi  Fe++ag g+ak Yt+lAl +iS++FrcLkdai +qi
  Ote100190400061|100190400061  77 ERQEIQMKKAKLVNMLDEVEQRYRQYQHQMQIVITWFEQAAGAGAAKTYTALALETISKQFRCLKDAILGQI 148
                                   79********************************************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005747.1E-603146IPR006563POX domain
PfamPF075263.6E-488144IPR006563POX domain
PROSITE profilePS5007112.115191254IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.608.2E-25193254IPR009057Homeodomain-like
CDDcd000861.36E-11194251No hitNo description
SMARTSM003895.1E-7194258IPR001356Homeobox domain
SuperFamilySSF466894.28E-15195253IPR009057Homeodomain-like
PfamPF059203.9E-18211250IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009610Biological Processresponse to symbiotic fungus
GO:0009737Biological Processresponse to abscisic acid
GO:0010197Biological Processpolar nucleus fusion
GO:0010201Biological Processresponse to continuous far red light stimulus by the high-irradiance response system
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
GO:0003677Molecular FunctionDNA binding
GO:0042803Molecular Functionprotein homodimerization activity
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 476 aa     Download sequence    Send to blast
GVNGVQSVLL SSKYLSAAQE LLDEVVNVGK GVKTAVESSK GQPKSNGDSA AAAASGEAHS  60
GGGDSSGKRG AELTTAERQE IQMKKAKLVN MLDEVEQRYR QYQHQMQIVI TWFEQAAGAG  120
AAKTYTALAL ETISKQFRCL KDAILGQIRG ASKSLGEEEN VEGKIEGSRL KYVDNQMRQQ  180
RALQQLGMIQ YNAWRPQRGL PERSVSVLRA WLFEHFLHPY PKDSDKLMLA KQTGLTRSQV  240
SNWFINARVR LXXXLEADGR GNVKSPGAEQ QRNKTFVDNF VNSNTVSPPP PSPNGTTISG  300
FKLMSEMGSS PKKLRISDML HSTTTAAATI PLPINMDSKP SDSDNDTMLM KFGGDRQERD  360
GFTLMGAPTN VIGGFGAYPM GDLGRFGTEQ FQTPYSGNGV SLTLGLPHCE NIAMSGAHQS  420
FLPNQTMQLG RTVEIGEAND FGGMDASANT HPANVYDINI QNRKRFAAQL LPDFVA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4xrs_B2e-14200251152Homeobox protein Meis1
4xrs_A2e-14200251152Homeobox protein Meis1
1x2n_A4e-141972511065Homeobox protein PKNOX1
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011094236.10.0PREDICTED: BEL1-like homeodomain protein 1
SwissprotQ9SJ561e-134BLH1_ARATH; BEL1-like homeodomain protein 1
TrEMBLA0A068UQ860.0A0A068UQ86_COFCA; Uncharacterized protein
STRINGPOPTR_0006s21950.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA14782467