PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ote100173900041
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Ocimeae; Ocimum
Family LBD
Protein Properties Length: 191aa    MW: 21478.4 Da    PI: 6.2916
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ote100173900041genomeOteDB-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260133.48.9e-42261251100
                        DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvil 81 
                                   +CaaCk+lrr+C+++Cvlapyfp ++p kf  +h++FGasn++k+l++l+ee+r da+s +vyeA+ar+rdPvyG++gvi 
  Ote100173900041|100173900041  26 PCAACKILRRRCVEKCVLAPYFPPHDPLKFTTAHRVFGASNIIKFLQELHEEQRADAVSNMVYEANARLRDPVYGCAGVIC 106
                                   7******************************************************************************** PP

                        DUF260  82 klqqqleqlkaelallkee 100
                                   +lq+q+++l+++la++++e
  Ote100173900041|100173900041 107 QLQKQVSELQEQLAKARAE 125
                                   ***************9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.08725126IPR004883Lateral organ boundaries, LOB
PfamPF031951.2E-4126123IPR004883Lateral organ boundaries, LOB
Gene3DG3DSA:1.20.58.606.1E-477151No hitNo description
Sequence ? help Back to Top
Protein Sequence    Length: 191 aa     Download sequence    Send to blast
MDSGGHTINT SSSSSSYPPH SVVISPCAAC KILRRRCVEK CVLAPYFPPH DPLKFTTAHR  60
VFGASNIIKF LQELHEEQRA DAVSNMVYEA NARLRDPVYG CAGVICQLQK QVSELQEQLA  120
KARAEIVNMQ CQHSNLMAVI CMEMAQSTHT MLPHDYQSLD EFSSSPNSYQ SKTSFLEDNN  180
NLELLWEPLW T
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011090094.12e-93PREDICTED: LOB domain-containing protein 1
SwissprotQ9SK086e-71LBD11_ARATH; LOB domain-containing protein 11
TrEMBLA0A061GTD17e-92A0A061GTD1_THECC; LOB domain-containing protein 1
STRINGGLYMA13G40370.23e-86(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA4324669