PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ote100168280021
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Ocimeae; Ocimum
Family TCP
Protein Properties Length: 127aa    MW: 14783.1 Da    PI: 11.4829
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ote100168280021genomeOteDB-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP52.22.4e-1672106337
                           TCP   3 gkkdrhskihTkvggRdRRvRlsaecaarfFdLqd 37 
                                   g+kdrhsk+hT +g+RdRR+Rls+++a++++dLq+
  Ote100168280021|100168280021  72 GGKDRHSKVHTVRGLRDRRIRLSVPTAIQLYDLQE 106
                                   79********************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF036341.1E-1473107IPR005333Transcription factor, TCP
PROSITE profilePS5136913.33673127IPR017887Transcription factor TCP subgroup
Sequence ? help Back to Top
Protein Sequence    Length: 127 aa     Download sequence    Send to blast
MWRHMVAIAP YLYLFPQHGV TNDEGSNPTM TSRERKLLPK QEDNPNHYRP TPPSRISQYK  60
NPRIARVSRS FGGKDRHSKV HTVRGLRDRR IRLSVPTAIQ LYDLQEKXXX XXXXEQSGRL  120
AAPRHKG
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006477684.12e-26PREDICTED: transcription factor TCP17-like isoform X1
TrEMBLA0A067FRC13e-25A0A067FRC1_CITSI; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA8212499