PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ote100161860021
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Ocimeae; Ocimum
Family TALE
Protein Properties Length: 241aa    MW: 27442.3 Da    PI: 5.6652
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ote100161860021genomeOteDB-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox29.31.4e-091692032155
                                   HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
                      Homeobox  21 knrypsaeereeLAkklgLterqVkvWFqNrRake 55 
                                   k +yps++++  LA+++gL+++q+ +WF N+R ++
  Ote100161860021|100161860021 169 KWPYPSESQKLALAESTGLDQKQINNWFINQRKRH 203
                                   569*****************************885 PP

2ELK41.82.2e-14123144122
                           ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                                   ELK qLlrKYsgyLgsLkqEF+
  Ote100161860021|100161860021 123 ELKGQLLRKYSGYLGSLKQEFM 144
                                   9********************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012561.5E-262677IPR005541KNOX2
PfamPF037911.8E-213076IPR005541KNOX2
PfamPF037893.6E-11123144IPR005539ELK domain
SMARTSM011882.8E-8123144IPR005539ELK domain
PROSITE profilePS5121311.174123143IPR005539ELK domain
PROSITE profilePS5007112.989143206IPR001356Homeobox domain
SuperFamilySSF466896.84E-20145220IPR009057Homeodomain-like
SMARTSM003897.4E-13145210IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.601.8E-28148208IPR009057Homeodomain-like
CDDcd000861.17E-12155207No hitNo description
PfamPF059203.6E-17163202IPR008422Homeobox KN domain
PROSITE patternPS000270181204IPR017970Homeobox, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009934Biological Processregulation of meristem structural organization
GO:0048440Biological Processcarpel development
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 241 aa     Download sequence    Send to blast
MAIGAPPEVV AKLEEACASA AVNRHGTSCV GEDPALDQFM EAYCEMLTKY EQELSKPFKE  60
AMLFLSRIEC QFKALTLSPS TSAGILHQDI ATACMDAMET NGSSEEDVDV NNSFIDPQAE  120
DRELKGQLLR KYSGYLGSLK QEFMKKRKKG KLPKEARQQL LDWWSRHYKW PYPSESQKLA  180
LAESTGLDQK QINNWFINQR KRHWKPSEDM QFVVMDAAHP HYYMDNVLGN PFPMDISPAL  240
L
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011086207.11e-142PREDICTED: homeobox protein SBH1-like
SwissprotO222991e-133LET6_SOLLC; Homeobox protein knotted-1-like LET6
TrEMBLA0A068U8C31e-146A0A068U8C3_COFCA; Uncharacterized protein
STRINGVIT_10s0116g00190.t011e-140(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA68352433