PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ote100150770061
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Ocimeae; Ocimum
Family HD-ZIP
Protein Properties Length: 216aa    MW: 24265 Da    PI: 4.7712
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ote100150770061genomeOteDB-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox61.61.2e-1968121356
                                   --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
                      Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                                   k++++t+eq+e Le+ F  ++++  +++++LAk+lgL+ rqV +WFqNrRa++k
  Ote100150770061|100150770061  68 KKRRLTAEQVEFLEKSFDVENKLEPHRKTQLAKQLGLQPRQVAIWFQNRRARYK 121
                                   56689************************************************9 PP

2HD-ZIP_I/II128.52.9e-4167159193
                   HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLe 81 
                                   ekkrrl++eqv++LE+sF+ e+kLep+rK++la++Lglqprqva+WFqnrRAR+ktk lEk+y++Lk++yd+lk++ e+L 
  Ote100150770061|100150770061  67 EKKRRLTAEQVEFLEKSFDVENKLEPHRKTQLAKQLGLQPRQVAIWFQNRRARYKTKLLEKQYDSLKSCYDKLKADYEALF 147
                                   69******************************************************************************* PP

                   HD-ZIP_I/II  82 keveeLreelke 93 
                                   +++++L++el++
  Ote100150770061|100150770061 148 SDNQKLKNELAN 159
                                   *******99975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007117.68663123IPR001356Homeobox domain
SuperFamilySSF466891.03E-1864123IPR009057Homeodomain-like
SMARTSM003898.1E-1866127IPR001356Homeobox domain
PfamPF000466.9E-1768121IPR001356Homeobox domain
CDDcd000861.23E-1768123No hitNo description
Gene3DG3DSA:1.10.10.603.7E-2069131IPR009057Homeodomain-like
PRINTSPR000312.4E-694103IPR000047Helix-turn-helix motif
PROSITE patternPS00027098121IPR017970Homeobox, conserved site
PRINTSPR000312.4E-6103119IPR000047Helix-turn-helix motif
PfamPF021832.0E-11124160IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 216 aa     Download sequence    Send to blast
MKGTGCGVLD DSHVMMKDDA ITSTSDLVDS LWMPTSFHGT APASASVVGF DQAGGENKRL  60
GDDEMAEKKR RLTAEQVEFL EKSFDVENKL EPHRKTQLAK QLGLQPRQVA IWFQNRRARY  120
KTKLLEKQYD SLKSCYDKLK ADYEALFSDN QKLKNELANL LKDGCDASSS GRSDVLDSDS  180
SGVLEIDQSQ DEDDLHPNSC NLGFPAQNQG TWFWQY
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011071034.12e-68PREDICTED: homeobox-leucine zipper protein HAT5-like
TrEMBLA0A022QM623e-56A0A022QM62_ERYGU; Uncharacterized protein
STRINGVIT_01s0026g01550.t011e-49(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA8252495