PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ote100139950071
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Ocimeae; Ocimum
Family TCP
Protein Properties Length: 278aa    MW: 31144 Da    PI: 6.511
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ote100139950071genomeOteDB-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP63.39.3e-201756140
                           TCP  1 aagkkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLG 40
                                  aag+kdrhsk++T++g+RdRRvRl a++a++f+d+qd+LG
  Ote100139950071|100139950071 17 AAGRKDRHSKVYTAKGPRDRRVRLAAHTAIQFYDVQDRLG 56
                                  689************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF036343.9E-171956IPR005333Transcription factor, TCP
PROSITE profilePS5136913.5832056IPR017887Transcription factor TCP subgroup
Sequence ? help Back to Top
Protein Sequence    Length: 278 aa     Download sequence    Send to blast
MKGGEIQQVD GGHLLRAAGR KDRHSKVYTA KGPRDRRVRL AAHTAIQFYD VQDRLGXXXX  60
XXXXXXXXXX XXXXXXXXXX XXXXXXXXXX XXXSNPSSTD LAMDHHSEGV RGYEIIHPSX  120
XXXXXXXXXX XXGSSFIVAT ESFFPTSSFA GFGNDPCPAE GEDLGLSLQT LNSNLPYQES  180
FQRIDGWNNG DGAVQSRVGI LSNSQQPIFP SARNELIPSN SALNPWNQRP LIPANHHHVD  240
PRTEKSSNFE SPFELGFRVP AWIYGDQEAE NHRSNPLN
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA66072234