PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ote100138780141
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Ocimeae; Ocimum
Family LBD
Protein Properties Length: 194aa    MW: 21706.6 Da    PI: 5.8539
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ote100138780141genomeOteDB-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260133.39.8e-42451441100
                        DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvil 81 
                                   +CaaCk+lrr+C+ +Cvlapyfp ++p kfa+vh++FGasn++kll++lpe++r da++s+vyeA+ar+rdP+yG++g+i 
  Ote100138780141|100138780141  45 PCAACKTLRRRCTVKCVLAPYFPPTEPLKFAVVHRIFGASNIVKLLQQLPEDQRADAVASMVYEANARLRDPIYGCAGTIC 125
                                   7******************************************************************************** PP

                        DUF260  82 klqqqleqlkaelallkee 100
                                   +lq+++++l++el+++++e
  Ote100138780141|100138780141 126 HLQKHIDELQVELSRMHAE 144
                                   **************99987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.69944145IPR004883Lateral organ boundaries, LOB
PfamPF031951.0E-4145142IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 194 aa     Download sequence    Send to blast
MNXXXXXXXX XXAVLEADCC TSVVSPPLPA ASSLPRPPPS AVISPCAACK TLRRRCTVKC  60
VLAPYFPPTE PLKFAVVHRI FGASNIVKLL QQLPEDQRAD AVASMVYEAN ARLRDPIYGC  120
AGTICHLQKH IDELQVELSR MHAEILNMQC QHANLLHQFY MKMATLDVQE DLLPYHEDST  180
TFFDEEVVGE PLWT
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011077047.12e-70PREDICTED: LOB domain-containing protein 1-like
RefseqXP_011027000.13e-70PREDICTED: LOB domain-containing protein 1-like
SwissprotQ9LQR06e-61LBD1_ARATH; LOB domain-containing protein 1
TrEMBLA0A022RH949e-71A0A022RH94_ERYGU; Uncharacterized protein
STRINGPOPTR_0008s04350.12e-68(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA4324669