PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ote100136040101
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Ocimeae; Ocimum
Family BBR-BPC
Protein Properties Length: 309aa    MW: 34326.1 Da    PI: 9.7794
Description BBR-BPC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ote100136040101genomeOteDB-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GAGA_bind375.68.6e-11513091301
                     GAGA_bind   1 mdddgsre..rnkg...yyepaaslkenlglqlmssiaerdakirernlalsekkaavaerdmaflqrdkalaernkalve 76 
                                   mdd+g  e  r+k+   ++     +++   +q+m+++aerda+i+ernla+sekk a+aerdma lqrd+a+aern+a++e
  Ote100136040101|100136040101   1 MDDSGPPEngRHKAppgQW----LMHQPSMKQIMAIMAERDAAIQERNLAVSEKKTALAERDMAILQRDTAIAERNNAIME 77 
                                   5666554445666521222....33334445************************************************** PP

                     GAGA_bind  77 rdnkllalllvensla....salpvgvqvlsgtksidslqq.lsepqledsavelreeeklealpieeaaeeakekkkkkk 152
                                   rdn+++al+++en+l+      +p+g+q+ +g+k+i++ qq +++ + + + ve++  +++ + pi   + + +++k+ k+
  Ote100136040101|100136040101  78 RDNAIAALQYRENALNngniPPCPPGCQIPRGVKHIHHPQQhQQHVHHQSHMVEMQIPDNVPVSPIPADPAKPRRTKRAKE 158
                                   **************997777789****************993334444444455555555555555555555555554444 PP

                     GAGA_bind 153 rqrak.kpkekkakkkkkksekskkkvkkesad.erskaekksidlvlngvslDestlPvPvCsCtGalrqCYkWGnGGWq 231
                                    ++a+  +k +k kk+k ++++++   +++  + + +k ++k++dl+ln+v++Dest+P+PvCsCtG+lr CYkWGnGGWq
  Ote100136040101|100136040101 159 VKQAApAKKPSKPKKVKLEGDDPEMGGSSDDLNrQVTKPNWKEQDLGLNHVAFDESTMPPPVCSCTGVLRPCYKWGNGGWQ 239
                                   4444303344556667777777766666666665779******************************************** PP

                     GAGA_bind 232 SaCCtttiSvyPLPvstkrrgaRiagrKmSqgafkklLekLaaeGydlsnpvDLkdhWAkHGtnkfvtir 301
                                   S+CCtt++S+yPLP+++++r+aR++grKmS++af+klL++LaaeG+dlsn vDLk+hWAkHGtn+++ti+
  Ote100136040101|100136040101 240 SSCCTTNLSMYPLPAVPNKRHARVGGRKMSGSAFNKLLSRLAAEGHDLSNSVDLKEHWAKHGTNRYITIK 309
                                   *********************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF062171.0E-1011309IPR010409GAGA-binding transcriptional activator
SMARTSM012261.4E-1591309IPR010409GAGA-binding transcriptional activator
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009723Biological Processresponse to ethylene
GO:0005730Cellular Componentnucleolus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0042803Molecular Functionprotein homodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 309 aa     Download sequence    Send to blast
MDDSGPPENG RHKAPPGQWL MHQPSMKQIM AIMAERDAAI QERNLAVSEK KTALAERDMA  60
ILQRDTAIAE RNNAIMERDN AIAALQYREN ALNNGNIPPC PPGCQIPRGV KHIHHPQQHQ  120
QHVHHQSHMV EMQIPDNVPV SPIPADPAKP RRTKRAKEVK QAAPAKKPSK PKKVKLEGDD  180
PEMGGSSDDL NRQVTKPNWK EQDLGLNHVA FDESTMPPPV CSCTGVLRPC YKWGNGGWQS  240
SCCTTNLSMY PLPAVPNKRH ARVGGRKMSG SAFNKLLSRL AAEGHDLSNS VDLKEHWAKH  300
GTNRYITIK
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00540DAPTransfer from AT5G42520Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015884822.11e-168PREDICTED: protein BASIC PENTACYSTEINE6
RefseqXP_015884823.11e-168PREDICTED: protein BASIC PENTACYSTEINE6
RefseqXP_015884824.11e-168PREDICTED: protein BASIC PENTACYSTEINE6
RefseqXP_015884825.11e-168PREDICTED: protein BASIC PENTACYSTEINE6
RefseqXP_015884826.11e-168PREDICTED: protein BASIC PENTACYSTEINE6
SwissprotQ8L9991e-136BPC6_ARATH; Protein BASIC PENTACYSTEINE6
TrEMBLI1JT521e-164I1JT52_SOYBN; Uncharacterized protein
STRINGGLYMA04G02860.11e-164(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA53532338