PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ote100131890071
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Ocimeae; Ocimum
Family TCP
Protein Properties Length: 166aa    MW: 18591.9 Da    PI: 9.4546
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ote100131890071genomeOteDB-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP106.63.9e-3370138270
                           TCP   2 agkkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssa 70 
                                    g+kdrhsk+ T++g+RdRRvRls+++a++f+dLqd+LG+d++sk++eWLl++a+ +i el+  +s+ +
  Ote100131890071|100131890071  70 SGGKDRHSKVLTSKGLRDRRVRLSVNTAIQFYDLQDRLGYDQPSKAVEWLLKAAESSIAELPPMNSPFP 138
                                   689***********************************************************9944433 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF036341.1E-3471152IPR005333Transcription factor, TCP
PROSITE profilePS5136931.99572130IPR017887Transcription factor TCP subgroup
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008285Biological Processnegative regulation of cell proliferation
GO:0009965Biological Processleaf morphogenesis
GO:0030154Biological Processcell differentiation
GO:0045962Biological Processpositive regulation of development, heterochronic
Sequence ? help Back to Top
Protein Sequence    Length: 166 aa     Download sequence    Send to blast
MKVDDQIQCK FARINNGGGK LGLNHKMDDQ YQDEEEEGDN RIGAAVDFGG GIGRFYGWPS  60
SRIVRVSRAS GGKDRHSKVL TSKGLRDRRV RLSVNTAIQF YDLQDRLGYD QPSKAVEWLL  120
KAAESSIAEL PPMNSPFPDT PKQMSAEKRT STGXXXXXXX XXXXXF
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00639PBMTransfer from Lj6g3v1946420Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011096599.16e-73PREDICTED: transcription factor TCP2-like
RefseqXP_011096600.16e-73PREDICTED: transcription factor TCP2-like
SwissprotQ9C7584e-42TCP24_ARATH; Transcription factor TCP24
TrEMBLA0A022QZI87e-68A0A022QZI8_ERYGU; Uncharacterized protein
STRINGVIT_10s0003g03910.t014e-56(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA24642252