PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ote100129170001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Ocimeae; Ocimum
Family ZF-HD
Protein Properties Length: 101aa    MW: 10712.3 Da    PI: 8.3554
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ote100129170001genomeOteDB-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer74.21.9e-2361101446
                   ZF-HD_dimer   4 vrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaAC 46 
                                   v YkeCl+NhAaslGghavDGCgEfmps+   +++++lkCaAC
  Ote100129170001|100129170001  61 VAYKECLRNHAASLGGHAVDGCGEFMPSP--ATDPTSLKCAAC 101
                                   79*************************94..457********* PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF047702.0E-1961101IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
ProDomPD1257741.0E-1361101IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152322.18263101IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015661.5E-2063101IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Sequence ? help Back to Top
Protein Sequence    Length: 101 aa     Download sequence    Send to blast
MXXXXXXXXX XXXLSNSAVK STDAEPESPT RIRPVKLPPP PPSGNGVLKR HAPPHLHPVL  60
VAYKECLRNH AASLGGHAVD GCGEFMPSPA TDPTSLKCAA C
Functional Description ? help Back to Top
Source Description
UniProtPutative transcription factor.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011085755.14e-33zinc-finger homeodomain protein 9
SwissprotQ9LHF04e-18ZHD9_ARATH; Zinc-finger homeodomain protein 9
TrEMBLA0A2G9HG831e-32A0A2G9HG83_9LAMI; Uncharacterized protein
STRINGXP_009797863.13e-28(Nicotiana sylvestris)
STRINGPGSC0003DMT4000343682e-28(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA10882485
Publications ? help Back to Top
  1. Li B, et al.
    Network-Guided Discovery of Extensive Epistasis between Transcription Factors Involved in Aliphatic Glucosinolate Biosynthesis.
    Plant Cell, 2018. 30(1): p. 178-195
    [PMID:29317470]