PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ote100127710061
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Ocimeae; Ocimum
Family TALE
Protein Properties Length: 565aa    MW: 63896.7 Da    PI: 7.5172
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ote100127710061genomeOteDB-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox27.36.2e-094134452254
                                   SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
                      Homeobox  22 nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                                    +yps++++  L++++gL+++qV++WF N R +
  Ote100127710061|100127710061 413 RSYPSEADKHVLSRQTGLSKNQVSNWFINARVR 445
                                   68*****************************88 PP

2BELL110.11.3e-35260331172
                          BELL   1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                                   er++ q++k kLl++leeVd rY +y+eq+q+v++sFe vag g+a pYt lA+ka+SrhFrc+kdai+ q+
  Ote100127710061|100127710061 260 ERADYQRRKIKLLTMLEEVDGRYARYCEQMQAVVNSFESVAGQGAAPPYTGLAQKAMSRHFRCIKDAIVAQL 331
                                   68999****************************************************************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005741.6E-51197329IPR006563POX domain
PfamPF075261.2E-44203328IPR006563POX domain
SMARTSM003891.6E-5362453IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.604.2E-23365455IPR009057Homeodomain-like
PROSITE profilePS5007111.013386449IPR001356Homeobox domain
SuperFamilySSF466891.03E-11413457IPR009057Homeodomain-like
PfamPF059206.6E-13413445IPR008422Homeobox KN domain
CDDcd000864.71E-8415450No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009965Biological Processleaf morphogenesis
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 565 aa     Download sequence    Send to blast
MSYANERSVT GKQQGEWMLR VQGFELEALP LDSAVQTPAY DAARGLLTAE IMNIQPWRKG  60
AGVTDFLDDQ IQHGYQLPAA AVNELPLMMR ANDEPSSSTT NSYLQKLAPV SSDSYLQGFH  120
HLANPAAEPP WIPRSGGGDS QSGRMIEGGG LSLSLRSLDA EELDKIRVGH GELLYQNQPQ  180
LFHSARVLDH YGLVEPATRT NFIRNSRYLK AAQELLTEFC CVQRGMLKNQ NRNPNNSILD  240
SDRAAPSPLK DHRPPISHAE RADYQRRKIK LLTMLEEVDG RYARYCEQMQ AVVNSFESVA  300
GQGAAPPYTG LAQKAMSRHF RCIKDAIVAQ LKGETPRLKA VEQKYRHQKS LQHMGMLDPD  360
SWRPQRGLPD RSVNILRAWL FEHFLNPXXX XXXXXXXXSI SFLLSHTHTE RGRSYPSEAD  420
KHVLSRQTGL SKNQVSNWFI NARVRLWKPM VEEMYQQEVQ DEVQPEEAEE TEPQSRAPMH  480
NTGTALTPLS RRGKMLTEND PSQNTINYSQ GKEVXXXXXX XXXXEYRVQA NSGTQAGDVS  540
LTLGLKHSEN VPRMNRLSIR DFEAY
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011083914.11e-178PREDICTED: BEL1-like homeodomain protein 4
TrEMBLK4BV621e-148K4BV62_SOLLC; Uncharacterized protein
STRINGSolyc04g079830.2.11e-147(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA60721721