PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ote100125860001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Ocimeae; Ocimum
Family TCP
Protein Properties Length: 145aa    MW: 16347 Da    PI: 10.6772
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ote100125860001genomeOteDB-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP64.83.1e-205296246
                           TCP  2 agkkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsk 46
                                   g+kdrhsk++T +g+RdRRvRls+++a++++dLq++LG+ ++sk
  Ote100125860001|100125860001 52 FGGKDRHSKVCTVRGLRDRRVRLSVPTAIQLYDLQERLGLSQPSK 96
                                  689*****************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5136917.36254112IPR017887Transcription factor TCP subgroup
PfamPF036342.8E-185496IPR005333Transcription factor, TCP
Sequence ? help Back to Top
Protein Sequence    Length: 145 aa     Download sequence    Send to blast
MILRDTDNFS PNKNSNAEDA XXXXXXXXXX XXXXSSWSRL KDPRIVRVSR AFGGKDRHSK  60
VCTVRGLRDR RVRLSVPTAI QLYDLQERLG LSQPSKPGMM ATTPFCTPHF SIANAAFDHH  120
NVARPFGFDV GADREQSKRG DLEGK
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
SwissprotQ9S7W52e-32TCP13_ARATH; Transcription factor TCP13
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA8212499