PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ote100119040051
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Ocimeae; Ocimum
Family BBR-BPC
Protein Properties Length: 84aa    MW: 9585.55 Da    PI: 11.4284
Description BBR-BPC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ote100119040051genomeOteDB-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GAGA_bind132.31e-402484241301
                     GAGA_bind 241 vyPLPvstkrrgaRiagrKmSqgafkklLekLaaeGydlsnpvDLkdhWAkHGtnkfvtir 301
                                    yPLP+stkrrgaRiagrKmSqgafkk+LekLa+eGy++ np+DL+++WAkHGtnkfvtir
  Ote100119040051|100119040051  24 LYPLPMSTKRRGARIAGRKMSQGAFKKVLEKLATEGYNFVNPIDLRTYWAKHGTNKFVTIR 84 
                                   7***********************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012268.3E-7184IPR010409GAGA-binding transcriptional activator
PfamPF062172.9E-382484IPR010409GAGA-binding transcriptional activator
Sequence ? help Back to Top
Protein Sequence    Length: 84 aa     Download sequence    Send to blast
MGVWGLAVSV LHXXXXXXXX XXXLYPLPMS TKRRGARIAG RKMSQGAFKK VLEKLATEGY  60
NFVNPIDLRT YWAKHGTNKF VTIR
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002521909.12e-35PREDICTED: protein BASIC PENTACYSTEINE2
RefseqXP_010066541.11e-35PREDICTED: protein BASIC PENTACYSTEINE2
RefseqXP_012072387.11e-35PREDICTED: protein BASIC PENTACYSTEINE2-like isoform X1
RefseqXP_012072388.11e-35PREDICTED: protein BASIC PENTACYSTEINE2-like isoform X2
SwissprotQ8GUC32e-33BBR_HORVU; Protein Barley B recombinant
TrEMBLK4BNZ41e-35K4BNZ4_SOLLC; Uncharacterized protein
STRINGSolyc04g008380.2.14e-35(Solanum lycopersicum)