PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ote100118750041
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Ocimeae; Ocimum
Family LBD
Protein Properties Length: 175aa    MW: 19473.2 Da    PI: 6.97
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ote100118750041genomeOteDB-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260132.91.2e-41351341100
                        DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvil 81 
                                   +CaaC++lrr+Ca+ Cvlapyfp ++p kfa+vh++FGasn++kllk+lpe +r d ++s+vyeA+ar+rdP+yG++gvi 
  Ote100118750041|100118750041  35 PCAACRILRRRCAETCVLAPYFPPTDPLKFAAVHRVFGASNIVKLLKKLPEAQRADGVRSMVYEANARLRDPIYGCTGVIC 115
                                   7******************************************************************************** PP

                        DUF260  82 klqqqleqlkaelallkee 100
                                   +lq+++++l++ela+++++
  Ote100118750041|100118750041 116 HLQKNIDELQVELARTQAQ 134
                                   **************99986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.10534135IPR004883Lateral organ boundaries, LOB
PfamPF031951.5E-4135132IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 175 aa     Download sequence    Send to blast
MDXXXXXXXX XGVAAAECCP SVVSPPRSLS VNMSPCAACR ILRRRCAETC VLAPYFPPTD  60
PLKFAAVHRV FGASNIVKLL KKLPEAQRAD GVRSMVYEAN ARLRDPIYGC TGVICHLQKN  120
IDELQVELAR TQAQFLNMQC QNANLLDQFY MQMATPDVEN APLHHENHTT FVDEG
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011077047.15e-65PREDICTED: LOB domain-containing protein 1-like
SwissprotQ9LQR06e-59LBD1_ARATH; LOB domain-containing protein 1
TrEMBLA0A022RH943e-63A0A022RH94_ERYGU; Uncharacterized protein
STRINGGLYMA13G40370.24e-62(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA4324669