PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ote100118480091
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Ocimeae; Ocimum
Family bZIP
Protein Properties Length: 154aa    MW: 18054 Da    PI: 6.9614
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ote100118480091genomeOteDB-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_145.61.5e-144291554
                                  CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                        bZIP_1  5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkk 54
                                  +++rr+++NRe+ArrsR RK+  ++eL   v  L +eN+ L+++l++ ++
  Ote100118480091|100118480091 42 RKQRRMISNRESARRSRMRKQRHLDELWSQVLRLRTENHNLIDKLNHVSE 91
                                  79******************************************999876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003383.0E-1638102IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.9940103IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1709.1E-1342115No hitNo description
SuperFamilySSF579594.88E-134292No hitNo description
PfamPF001703.0E-124291IPR004827Basic-leucine zipper domain
CDDcd147021.07E-174394No hitNo description
PROSITE patternPS0003604560IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 154 aa     Download sequence    Send to blast
MFLPNYNTSP LQSATQEFSP NSTCNSTSDE AEDHQLRVID ERKQRRMISN RESARRSRMR  60
KQRHLDELWS QVLRLRTENH NLIDKLNHVS ESHDRVVQEN AKLKEEASDL RQMLTDIHIS  120
NSYTIFRDLD DISCNTAHLR AESSNQPVTT NLLH
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in somatic embryogenesis. Acts as positive regulator of BHLH109. {ECO:0000269|PubMed:26973252}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011077776.17e-82basic leucine zipper 43
SwissprotQ9FMC23e-39BZP43_ARATH; Basic leucine zipper 43
TrEMBLA0A2G9I8252e-77A0A2G9I825_9LAMI; Uncharacterized protein
STRINGcassava4.1_022183m2e-68(Manihot esculenta)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA9472492
Publications ? help Back to Top
  1. Nowak K,Gaj MD
    Stress-related function of bHLH109 in somatic embryo induction in Arabidopsis.
    J. Plant Physiol., 2016. 193: p. 119-26
    [PMID:26973252]
  2. Ezer D, et al.
    The G-Box Transcriptional Regulatory Code in Arabidopsis.
    Plant Physiol., 2017. 175(2): p. 628-640
    [PMID:28864470]