PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ote100118030031
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Ocimeae; Ocimum
Family VOZ
Protein Properties Length: 502aa    MW: 55823.8 Da    PI: 5.0005
Description VOZ family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ote100118030031genomeOteDB-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1VOZ417.72e-1282284471217
                           VOZ   1 pppsaflgpkcalwdctrpaqgsewlq...dycssfhatlalneglpgttpvlrpkgidlkdgllfaalsakvqgkevgip 78 
                                   pppsaf+gpkcalwdc+rpa g +w+q   dycs +ha la  eg pg  pv+rp+gi+lkd++lfaal ak+qgk+vgip
  Ote100118030031|100118030031 228 PPPSAFMGPKCALWDCPRPALGLDWCQksdDYCSIYHAGLAPSEGYPGRLPVVRPGGISLKDDVLFAALGAKAQGKDVGIP 308
                                   89***********************976668************************************************** PP

                           VOZ  79 ecegaatakspwnaaelfdlsllegetirewlffdkprrafesgnrkqrslpdysgrgwhesrkqvmkefgglkrsyymdp 159
                                   ecegaat+kspwna+elfdl++l+getirewlffdkprrafesgnrkqrslpdy+grgwhesrkqvm++fgglkrsyymdp
  Ote100118030031|100118030031 309 ECEGAATTKSPWNAPELFDLAVLDGETIREWLFFDKPRRAFESGNRKQRSLPDYNGRGWHESRKQVMNQFGGLKRSYYMDP 389
                                   ********************************************************************************* PP

                           VOZ 160 qpsssfewhlyeyeineldalalyrlelklvdekksakgkvskdsladlqkklgrlta 217
                                   qp+++fewhlyeyein++da+alyrle+k  d+kks+kgk+ +ds+adlqk++grlta
  Ote100118030031|100118030031 390 QPMENFEWHLYEYEINKYDACALYRLEVKRGDGKKSPKGKLVNDSVADLQKQMGRLTA 447
                                   ********************************************************97 PP

Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009408Biological Processresponse to heat
GO:0009414Biological Processresponse to water deprivation
GO:0009631Biological Processcold acclimation
GO:0009816Biological Processdefense response to bacterium, incompatible interaction
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0048578Biological Processpositive regulation of long-day photoperiodism, flowering
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 502 aa     Download sequence    Send to blast
MGKSSKTGAC KSSSHQLFKD RAKNRVDDLQ GVFSDLQSAR KDSRNIDVAV LEEQVQQMLR  60
EWKAELNEPS PASSLQQLWG YYSAFCICPL VDCSNFVLLC EGSLGFSSEI CRLLQLCEEE  120
DDATSALAAP KPDPDAQKAV GGYTSQENFN VPKGAQEQGF QSVDQSKAAA MGVNIEMNNM  180
NMPSQLDYHS FDFHHDFEQL YLMGFDGTGF TAEDVMPQIS GYQPNISPPP SAFMGPKCAL  240
WDCPRPALGL DWCQKSDDYC SIYHAGLAPS EGYPGRLPVV RPGGISLKDD VLFAALGAKA  300
QGKDVGIPEC EGAATTKSPW NAPELFDLAV LDGETIREWL FFDKPRRAFE SGNRKQRSLP  360
DYNGRGWHES RKQVMNQFGG LKRSYYMDPQ PMENFEWHLY EYEINKYDAC ALYRLEVKRG  420
DGKKSPKGKL VNDSVADLQK QMGRLTAEFP NEKQRAVKGR GKTNIKDANA RIYNAPPLPP  480
PAVSPGEAVD YLVDDISGYY LT
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator acting positively in the phytochrome B signaling pathway. Functions redundantly with VOZ2 to promote flowering downstream of phytochrome B (phyB). Down-regulates 'FLOWERING LOCUS C' (FLC) and up-regulates 'FLOWERING LOCUS T' (FT). Binds to the 38-bp cis-acting region of the AVP1 gene. Interacts with phyB in the cytoplasm and is translocated to the nucleus at signal transmission, where it is subjected to degradation in a phytochrome-dependent manner. {ECO:0000269|PubMed:15295067, ECO:0000269|PubMed:22904146}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By far-red light. {ECO:0000269|PubMed:22904146}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011096373.20.0transcription factor VOZ1, partial
SwissprotQ9SGQ00.0VOZ1_ARATH; Transcription factor VOZ1
TrEMBLA0A4D8ZHY00.0A0A4D8ZHY0_SALSN; Uncharacterized protein
STRINGMigut.M01093.1.p0.0(Erythranthe guttata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA28182454
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Yasui Y,Kohchi T
    VASCULAR PLANT ONE-ZINC FINGER1 and VOZ2 repress the FLOWERING LOCUS C clade members to control flowering time in Arabidopsis.
    Biosci. Biotechnol. Biochem., 2014. 78(11): p. 1850-5
    [PMID:25351333]
  3. Kumar S,Choudhary P,Gupta M,Nath U
    VASCULAR PLANT ONE-ZINC FINGER1 (VOZ1) and VOZ2 Interact with CONSTANS and Promote Photoperiodic Flowering Transition.
    Plant Physiol., 2018. 176(4): p. 2917-2930
    [PMID:29507119]
  4. Song C,Lee J,Kim T,Hong JC,Lim CO
    VOZ1, a transcriptional repressor of DREB2C, mediates heat stress responses in Arabidopsis.
    Planta, 2018. 247(6): p. 1439-1448
    [PMID:29536220]