PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ote100110840011
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Ocimeae; Ocimum
Family LBD
Protein Properties Length: 132aa    MW: 14627.8 Da    PI: 9.0511
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ote100110840011genomeOteDB-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260122.32.6e-3847132186
                        DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvil 81 
                                   +CaaCk+lrr+Ca++C+++pyf  ++p+kfa vhk+FGasnv+k+l ++pe++r da++slvyeA++r+rdPvyG++g i+
  Ote100110840011|100110840011  47 PCAACKLLRRRCAQECPFSPYFSPHEPHKFASVHKVFGASNVSKMLMEVPETQRADAANSLVYEANVRLRDPVYGCMGAIS 127
                                   7******************************************************************************** PP

                        DUF260  82 klqqq 86 
                                   +lqqq
  Ote100110840011|100110840011 128 ALQQQ 132
                                   ***97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089124.39646132IPR004883Lateral organ boundaries, LOB
PfamPF031959.9E-3947132IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 132 aa     Download sequence    Send to blast
MSTERERFEE IGKKIKREVD AAAVPHQQMG GRRHVLGAAG TLNTITPCAA CKLLRRRCAQ  60
ECPFSPYFSP HEPHKFASVH KVFGASNVSK MLMEVPETQR ADAANSLVYE ANVRLRDPVY  120
GCMGAISALQ QQ
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002520837.13e-81PREDICTED: LOB domain-containing protein 15
RefseqXP_015877527.15e-81PREDICTED: LOB domain-containing protein 15
SwissprotQ8L5T56e-79LBD15_ARATH; LOB domain-containing protein 15
TrEMBLB9S4B84e-81B9S4B8_RICCO; LOB domain-containing protein, putative
STRINGVIT_13s0067g02380.t013e-79(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA4324669