PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ote100110840001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Ocimeae; Ocimum
Family LBD
Protein Properties Length: 211aa    MW: 23567 Da    PI: 8.7358
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ote100110840001genomeOteDB-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260134.44.5e-42471471101
                        DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvil 81 
                                   +CaaCk+lrr+Ca++C+++pyf  ++p+kfa vhk+FGasnv+k+l ++pe++r da++slvyeA++r+rdPvyG++g i+
  Ote100110840001|100110840001  47 PCAACKLLRRRCAQECPFSPYFSPHEPHKFASVHKVFGASNVSKMLMEVPETQRADAANSLVYEANVRLRDPVYGCMGAIS 127
                                   7******************************************************************************** PP

                        DUF260  82 klqqqleqlkaelallkeel 101
                                   +lqqq++ l+ael+++++e+
  Ote100110840001|100110840001 128 ALQQQVQVLQAELNAVRNEI 147
                                   ***************99875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.91746147IPR004883Lateral organ boundaries, LOB
PfamPF031956.3E-4247144IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 211 aa     Download sequence    Send to blast
MSTERERFEE IGKKIKREVD AAAVPHQQMG GRRHVLGAAG TLNTITPCAA CKLLRRRCAQ  60
ECPFSPYFSP HEPHKFASVH KVFGASNVSK MLMEVPETQR ADAANSLVYE ANVRLRDPVY  120
GCMGAISALQ QQVQVLQAEL NAVRNEILKY KFKESTMLPS SHISLLSSXX XXXXXXXXXX  180
XXXXXXXXXX XXISTAADFT TISNENISYL S
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007011230.11e-103LOB domain-containing protein 15
SwissprotQ8L5T55e-87LBD15_ARATH; LOB domain-containing protein 15
TrEMBLA0A061FRT31e-103A0A061FRT3_THECC; LOB domain-containing protein 15
STRINGVIT_13s0067g02380.t011e-101(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA4324669