PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ote100109020021
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Ocimeae; Ocimum
Family bZIP
Protein Properties Length: 360aa    MW: 40593.3 Da    PI: 8.2161
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ote100109020021genomeOteDB-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_136.41.1e-1174105233
                                   XXXCHHHCHHHHHHHHHHHHHHHHHHHHHHHH CS
                        bZIP_1   2 kelkrerrkqkNReAArrsRqRKkaeieeLee 33 
                                   + +k+ rr+++NReAAr+sR+RKka++++Le+
  Ote100109020021|100109020021  74 PTDKVMRRLAQNREAARKSRLRKKAYVQQLET 105
                                   5789**************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1704.7E-868117No hitNo description
SMARTSM003381.4E-573131IPR004827Basic-leucine zipper domain
PfamPF001701.1E-875105IPR004827Basic-leucine zipper domain
PROSITE profilePS502178.77275117IPR004827Basic-leucine zipper domain
SuperFamilySSF579595.98E-777112No hitNo description
PROSITE patternPS0003608095IPR004827Basic-leucine zipper domain
PfamPF141442.4E-27163238IPR025422Transcription factor TGA like domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 360 aa     Download sequence    Send to blast
MNSTSTQFVP SRRMGIYEPI HQMAMWGDFK GNTCLDTSSP IILEVDPKLD NQSEDTSHGT  60
VGPSNKYEQE ASKPTDKVMR RLAQNREAAR KSRLRKKAYV QQLETSKLRL LQLEQELGRA  120
QKQGLYTGSA LDASPLGYGG STNPGIATFE MEYGHWVEEQ DRQISDLRKA LQTEIGVSEL  180
QIFVDGGMRH YFNLFTMKAT AAKADVFYLM SGMWKTSAER FFFWIGGFRP SELLKVLLPH  240
LEPLSEQQRL DLGTLAQLCQ QAEDALSQGM EKLHQILGEA IAKHLGEGNY LPQIGAAIEK  300
LEALVRFVGQ ADHLRQETLQ QISRILTTRQ AARGLLALGE YFQRLRALSS LWSSRPRELS
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator that binds specifically to the DNA sequence 5'-TGACG-3'. Recognizes ocs elements like the as-1 motif of the cauliflower mosaic virus 35S promoter. Binding to the as-1-like cis elements mediate auxin- and salicylic acid-inducible transcription. Could also bind to the Hex-motif (5'-TGACGTGG-3') another cis-acting element found in plant histone promoters.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00642SELEXTransfer from LOC107771743Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011097617.10.0TGACG-sequence-specific DNA-binding protein TGA-1A isoform X4
SwissprotP142321e-175TGA1A_TOBAC; TGACG-sequence-specific DNA-binding protein TGA-1A
TrEMBLA0A4D9AZ450.0A0A4D9AZ45_SALSN; Transcription factor TGA
STRINGMigut.L00088.1.p0.0(Erythranthe guttata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA7802497
Publications ? help Back to Top
  1. Klinedinst S,Pascuzzi P,Redman J,Desai M,Arias J
    A xenobiotic-stress-activated transcription factor and its cognate target genes are preferentially expressed in root tip meristems.
    Plant Mol. Biol., 2000. 42(5): p. 679-88
    [PMID:10809441]
  2. Johnson C,Boden E,Desai M,Pascuzzi P,Arias J
    In vivo target promoter-binding activities of a xenobiotic stress-activated TGA factor.
    Plant J., 2001. 28(2): p. 237-43
    [PMID:11722767]
  3. Katagiri F,Seipel K,Chua NH
    Identification of a novel dimer stabilization region in a plant bZIP transcription activator.
    Mol. Cell. Biol., 1992. 12(11): p. 4809-16
    [PMID:1406663]
  4. Miao ZH,Lam E
    Construction of a trans-dominant inhibitor for members of the TGA family of transcription factors conserved in higher plants.
    Plant J., 1995. 7(6): p. 887-96
    [PMID:7599649]
  5. Pascuzzi P,Hamilton D,Bodily K,Arias J
    Auxin-induced stress potentiates trans-activation by a conserved plant basic/leucine-zipper factor.
    J. Biol. Chem., 1998. 273(41): p. 26631-7
    [PMID:9756903]