PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ote100095220051
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Ocimeae; Ocimum
Family LBD
Protein Properties Length: 76aa    MW: 8602.99 Da    PI: 9.4845
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ote100095220051genomeOteDB-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF26025.53.8e-082063144
                        DUF260  1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlk 44
                                  aC  C +++r Ca dC + pyf+a+ + +++n+hkl+  + v +
  Ote100095220051|100095220051 20 ACPFCSHHGRWCAVDCLMTPYFAAATEMELRNLHKLYTYNSVKR 63
                                  6999*********************************9998866 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS508918.9091976IPR004883Lateral organ boundaries, LOB
PfamPF031957.8E-62063IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 76 aa     Download sequence    Send to blast
MSSGKPPLHP STAGNFRRVA CPFCSHHGRW CAVDCLMTPY FAAATEMELR NLHKLYTYNS  60
VKRRCSFCCR TTAKTS