PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ote100090230021
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Ocimeae; Ocimum
Family ERF
Protein Properties Length: 118aa    MW: 13574 Da    PI: 5.8175
Description ERF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ote100090230021genomeOteDB-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1AP259.76.7e-191567256
                           AP2  2 gykGVrwdkkrgrWvAeIrdpsengkrkrfslgkfgtaeeAakaaiaarkklege 56
                                  +y+GVr +  +g+++AeIrd s +g  +r++lg+f taeeAa+a+++a+ +++g+
  Ote100090230021|100090230021 15 KYRGVRKRQ-WGKYAAEIRDTSRQG-AARVWLGTFKTAEEAARAYDRAAYQMRGH 67
                                  8*****888.**********43333.5**************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5103222.9581574IPR001471AP2/ERF domain
SuperFamilySSF541714.32E-211575IPR016177DNA-binding domain
SMARTSM003801.5E-301580IPR001471AP2/ERF domain
PfamPF008471.2E-131567IPR001471AP2/ERF domain
Gene3DG3DSA:3.30.730.101.4E-291576IPR001471AP2/ERF domain
CDDcd000181.99E-171575No hitNo description
PRINTSPR003673.0E-111627IPR001471AP2/ERF domain
PRINTSPR003673.0E-114056IPR001471AP2/ERF domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 118 aa     Download sequence    Send to blast
MEESGSRKGD GGEVKYRGVR KRQWGKYAAE IRDTSRQGAA RVWLGTFKTA EEAARAYDRA  60
AYQMRGHLAI LNFPEEYNMP SSSSHFAAPS STERQVIEFE YYDDKLLEEL LDDNKRDN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5wx9_A7e-331510614114Ethylene-responsive transcription factor ERF096
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbably acts as a transcriptional activator. Binds to the GCC-box pathogenesis-related promoter element. May be involved in the regulation of gene expression by stress factors and by components of stress signal transduction pathways (By similarity). {ECO:0000250}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025886110.12e-48ethylene-responsive transcription factor ERF098-like
SwissprotQ9LTC51e-37ERF98_ARATH; Ethylene-responsive transcription factor ERF098
TrEMBLA0A2G9I9T02e-56A0A2G9I9T0_9LAMI; Uncharacterized protein
STRINGSolyc03g005500.1.18e-48(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA21241165
Publications ? help Back to Top
  1. Van den Broeck L, et al.
    From network to phenotype: the dynamic wiring of an Arabidopsis transcriptional network induced by osmotic stress.
    Mol. Syst. Biol., 2017. 13(12): p. 961
    [PMID:29269383]