PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ote100085580021
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Ocimeae; Ocimum
Family TALE
Protein Properties Length: 287aa    MW: 33001.1 Da    PI: 4.652
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ote100085580021genomeOteDB-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox27.55.4e-092342682155
                                   HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
                      Homeobox  21 knrypsaeereeLAkklgLterqVkvWFqNrRake 55 
                                   k +yp+++++  LA+ +gL+++q+ +WF N+R ++
  Ote100085580021|100085580021 234 KWPYPTEADKIGLAETTGLDQKQINNWFINQRKRH 268
                                   569*****************************885 PP

2ELK248.9e-09188209122
                           ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                                   ELK+ Llr Y+ +++sL+ EFs
  Ote100085580021|100085580021 188 ELKEKLLRMYGNHISSLRLEFS 209
                                   9********************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012552.3E-2070114IPR005540KNOX1
PfamPF037905.5E-2072112IPR005540KNOX1
SMARTSM012562.7E-8104157IPR005541KNOX2
PfamPF037916.6E-14122156IPR005541KNOX2
PROSITE profilePS512139.76188208IPR005539ELK domain
PfamPF037891.7E-5188209IPR005539ELK domain
SMARTSM011881.1E-4188209IPR005539ELK domain
PROSITE profilePS5007112.746208271IPR001356Homeobox domain
SuperFamilySSF466891.15E-18209281IPR009057Homeodomain-like
SMARTSM003899.3E-12210275IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.605.6E-27213271IPR009057Homeodomain-like
CDDcd000867.86E-13220271No hitNo description
PfamPF059205.1E-17228267IPR008422Homeobox KN domain
PROSITE patternPS000270246269IPR017970Homeobox, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010073Biological Processmeristem maintenance
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 287 aa     Download sequence    Send to blast
MDEMYGVDPR GGEYAEKALM SPENLIIPAE YNQYHYHSLM YGSDELGFQC CNDSASVDVH  60
NQTQDEEDSS LIKAKISSHP SYSKMVDAYI DCQKVGAPPE IACVLDEIRR EKDLCKEDAV  120
SMYCDILVKY KSDLSRPFDE ATSFLTDIEA QLLNLCNEFL DEAAAVSSSE EEIEVGIEEA  180
GTKREDRELK EKLLRMYGNH ISSLRLEFSK KKKKGKLPKE ARQTLLNWWN LHSKWPYPTE  240
ADKIGLAETT GLDQKQINNW FINQRKRHWK SPENMHLDVM DNFAPQD
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011071110.11e-127PREDICTED: homeobox protein knotted-1-like 6
SwissprotQ84JS61e-98KNAT6_ARATH; Homeobox protein knotted-1-like 6
TrEMBLD7TDJ71e-113D7TDJ7_VITVI; Putative uncharacterized protein
STRINGVIT_01s0127g00210.t011e-113(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA7532480