PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ote100082580142
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Ocimeae; Ocimum
Family G2-like
Protein Properties Length: 308aa    MW: 34226.9 Da    PI: 5.6808
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ote100082580142genomeOteDB-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like1031.9e-3282135154
                       G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYR 54 
                                   kprlrWt +LH+rFv+av+qLGG+ekAtPkti+++m+vkgLtl+h+kSHLQkY 
  Ote100082580142|100082580142  82 KPRLRWTADLHDRFVDAVTQLGGPEKATPKTIMRTMGVKGLTLYHLKSHLQKYW 135
                                   79***************************************************5 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512949.32179139IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.2E-3080136IPR009057Homeodomain-like
SuperFamilySSF466891.25E-1582136IPR009057Homeodomain-like
TIGRFAMsTIGR015572.3E-2382136IPR006447Myb domain, plants
PfamPF002491.6E-784134IPR001005SANT/Myb domain
PfamPF143791.9E-24171217IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010628Biological Processpositive regulation of gene expression
GO:0016036Biological Processcellular response to phosphate starvation
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 308 aa     Download sequence    Send to blast
MDQIRTATDE DDWTRLXXXX XXXXXXXXXX XXXXXXXXDR RIRLEGWRIN AAVEAGGLDY  60
QGSLDGTYLP GDACLLLSSD PKPRLRWTAD LHDRFVDAVT QLGGPEKATP KTIMRTMGVK  120
GLTLYHLKSH LQKYWLGNLA SSKELTETSK DGSSTSASLK TMAQDINDGY QVTEALRVQM  180
EVQRRLHEQL EVQQHPQIRI EAQSKYLQSI LDKACKALDD QAVACAGLEA ARKELSELAI  240
KVANDCNGIL SVRSLSHNDS DMDKNSIPYL PARLGECSID NDVMSNGSLD SQAAALKXXX  300
XXKAAAFI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A2e-1882134254Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B2e-1882134254Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_A1e-1882134153Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B1e-1882134153Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C1e-1882134153Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D1e-1882134153Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A2e-1882134254Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C2e-1882134254Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D2e-1882134254Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F2e-1882134254Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H2e-1882134254Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J2e-1882134254Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator (PubMed:26586833). Acts redundantly with PHR1 as a key component of the central regulatory system controlling transcriptional responses to Pi starvation (PubMed:26586833). Binds in a sequence-specific manner to phosphate starvation-regulated promoters (PubMed:26586833). {ECO:0000269|PubMed:26586833}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00378DAPTransfer from AT3G24120Download
Motif logo
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Up-regulated in roots by low Pi. {ECO:0000269|PubMed:26586833}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011091432.11e-127protein PHR1-LIKE 2 isoform X2
SwissprotQ94A576e-98PHL2_ARATH; Protein PHR1-LIKE 2
TrEMBLA0A4D9BKZ21e-116A0A4D9BKZ2_SALSN; Uncharacterized protein
STRINGXP_010241363.11e-109(Nelumbo nucifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA37912344
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]