PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ote100077010071
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Ocimeae; Ocimum
Family LBD
Protein Properties Length: 189aa    MW: 21081.1 Da    PI: 5.9936
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ote100077010071genomeOteDB-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF2601361.4e-42271261100
                        DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvil 81 
                                   +CaaCk+lrr+C+++Cvlapyfp ++p kf  +h++FGasn++k+l++lpee+r da+ss+vyeA+ar+rdPvyG++g i 
  Ote100077010071|100077010071  27 PCAACKILRRRCVEKCVLAPYFPPHDPLKFSTAHRVFGASNIIKFLQELPEEQRADAVSSMVYEANARLRDPVYGCAGAIC 107
                                   7******************************************************************************** PP

                        DUF260  82 klqqqleqlkaelallkee 100
                                   +lq+q+++l+++la++++e
  Ote100077010071|100077010071 108 QLQKQVNELQEQLAKAQAE 126
                                   ***************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.28526127IPR004883Lateral organ boundaries, LOB
PfamPF031956.7E-4327124IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 189 aa     Download sequence    Send to blast
MKMDGGDTIN TSSSSSSYPP HSVVLSPCAA CKILRRRCVE KCVLAPYFPP HDPLKFSTAH  60
RVFGASNIIK FLQELPEEQR ADAVSSMVYE ANARLRDPVY GCAGAICQLQ KQVNELQEQL  120
AKAQAEMVNM QCQHSNLMAL ICMEMAQSTQ TMLPHEEQSF GGSPNSYQSK TSFIEDYNNL  180
GILWEPLWT
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011090094.15e-92PREDICTED: LOB domain-containing protein 1
SwissprotQ9LQR01e-72LBD1_ARATH; LOB domain-containing protein 1
TrEMBLA0A061GTD13e-91A0A061GTD1_THECC; LOB domain-containing protein 1
STRINGVIT_06s0004g03330.t015e-87(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA4324669