PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ote100072030011
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Ocimeae; Ocimum
Family TALE
Protein Properties Length: 157aa    MW: 18314.7 Da    PI: 8.7699
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ote100072030011genomeOteDB-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox31.72.5e-10891242055
                                   HHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
                      Homeobox  20 eknrypsaeereeLAkklgLterqVkvWFqNrRake 55 
                                   +k +yps++e+  LA+++gL+++q+ +WF N+R ++
  Ote100072030011|100072030011  89 YKWPYPSESEKVALAESTGLDQKQINNWFINQRKRH 124
                                   4679*****************************985 PP

2ELK37.64.8e-134465122
                           ELK  1 ELKhqLlrKYsgyLgsLkqEFs 22
                                  ELK++Ll+KYsgyL+sLkqE+s
  Ote100072030011|100072030011 44 ELKNHLLKKYSGYLSSLKQELS 65
                                  9*******************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF037892.3E-104465IPR005539ELK domain
SMARTSM011881.0E-64465IPR005539ELK domain
PROSITE profilePS5121311.2434464IPR005539ELK domain
PROSITE profilePS5007113.11964127IPR001356Homeobox domain
SuperFamilySSF466891.03E-2065140IPR009057Homeodomain-like
SMARTSM003891.8E-1366131IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.602.6E-2869130IPR009057Homeodomain-like
CDDcd000869.73E-1376128No hitNo description
PfamPF059202.8E-1784123IPR008422Homeobox KN domain
PROSITE patternPS000270102125IPR017970Homeobox, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 157 aa     Download sequence    Send to blast
MVFFLSELHE LDKSEGIGSS DDDQDNSGGE TALREIDPRA EDRELKNHLL KKYSGYLSSL  60
KQELSKKKKK GKLPKEARQK LLNWWELHYK WPYPSESEKV ALAESTGLDQ KQINNWFINQ  120
RKRHWKPSED MQFMVMDGLH PHNAALYMGN APYRLGP
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015572849.12e-85PREDICTED: homeotic protein knotted-1
RefseqXP_012068139.15e-85PREDICTED: homeobox protein knotted-1-like 2
RefseqXP_011074319.16e-85PREDICTED: homeotic protein knotted-1
SwissprotO041343e-84KNAP1_MALDO; Homeobox protein knotted-1-like 1
TrEMBLA8QXP72e-87A8QXP7_IPOBA; Class-I knotted1-like homeobox protein IBKN3
STRINGVIT_18s0001g08380.t012e-83(Vitis vinifera)
STRINGPOPTR_0002s11400.11e-84(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA49732333