PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ote100069560001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Ocimeae; Ocimum
Family ERF
Protein Properties Length: 139aa    MW: 15584.3 Da    PI: 5.6302
Description ERF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ote100069560001genomeOteDB-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1AP247.35e-1537791256
                           AP2 12 rgrWvAeIrdpsengkrkrfslgkfgtaeeAakaaiaarkklege 56
                                  +g+++AeIrd   ng  +r++lg+f taeeAa+a++ a+ +++g+
  Ote100069560001|100069560001 37 WGKYAAEIRDSARNG--ARVWLGTFNTAEEAARAYDSAAYAMRGH 79
                                  9*********32244..**************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5103219.7041986IPR001471AP2/ERF domain
SuperFamilySSF541719.81E-193587IPR016177DNA-binding domain
SMARTSM003802.1E-223692IPR001471AP2/ERF domain
Gene3DG3DSA:3.30.730.109.5E-253687IPR001471AP2/ERF domain
CDDcd000183.85E-193787No hitNo description
PfamPF008477.8E-103779IPR001471AP2/ERF domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 139 aa     Download sequence    Send to blast
MDNRSRRGGE NDDGGGEIKY RXXXXXXXXX XXXXXXWGKY AAEIRDSARN GARVWLGTFN  60
TAEEAARAYD SAAYAMRGHL AILNFPEEHN LPSSSSHFAS STSTTGSMQG RGGGDHGRQV  120
FEFECYDDKL LEDLLDYKR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5wx9_A1e-273713023114Ethylene-responsive transcription factor ERF096
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbably acts as a transcriptional activator. Binds to the GCC-box pathogenesis-related promoter element. May be involved in the regulation of gene expression by stress factors and by components of stress signal transduction pathways (By similarity). {ECO:0000250}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010039174.14e-37PREDICTED: ethylene-responsive transcription factor ERF096
RefseqXP_012843103.12e-36PREDICTED: ethylene-responsive transcription factor 1B-like
SwissprotQ9LTC52e-30ERF98_ARATH; Ethylene-responsive transcription factor ERF098
TrEMBLA0A2G9I9T02e-45A0A2G9I9T0_9LAMI; Uncharacterized protein
STRINGMigut.N00263.1.p3e-38(Erythranthe guttata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA21241165
Publications ? help Back to Top
  1. Van den Broeck L, et al.
    From network to phenotype: the dynamic wiring of an Arabidopsis transcriptional network induced by osmotic stress.
    Mol. Syst. Biol., 2017. 13(12): p. 961
    [PMID:29269383]