PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ote100067080011
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Ocimeae; Ocimum
Family NAC
Protein Properties Length: 286aa    MW: 32933.8 Da    PI: 6.6248
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ote100067080011genomeOteDB-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM166.96.8e-52101391129
                           NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksg 81 
                                   lppGfrF P+deelv++yL+kk+++++++   ++ e+d++ +ePw+Lp  +k +++ewyfFs rd+kyatg r+nrat+sg
  Ote100067080011|100067080011  10 LPPGFRFYPSDEELVCHYLHKKIANEETDRRGTLVEIDLHICEPWQLPDVAKLNSNEWYFFSFRDRKYATGYRTNRATNSG 90 
                                   79*************************999999***************87778899************************* PP

                           NAM  82 yWkatgkdkevlsk.kgelvglkktLvfykgrapkgektdWvmheyrle 129
                                   yWkatgkd++v++  ++++vg++ktLvfyk+rap+g+kt W+mhe+rle
  Ote100067080011|100067080011  91 YWKATGKDRNVVDPvSRAVVGMRKTLVFYKNRAPNGVKTGWIMHEFRLE 139
                                   *************988889***************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.4E-618157IPR003441NAC domain
PROSITE profilePS5100558.30610157IPR003441NAC domain
PfamPF023655.9E-2811138IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 286 aa     Download sequence    Send to blast
MGLRDIGCTL PPGFRFYPSD EELVCHYLHK KIANEETDRR GTLVEIDLHI CEPWQLPDVA  60
KLNSNEWYFF SFRDRKYATG YRTNRATNSG YWKATGKDRN VVDPVSRAVV GMRKTLVFYK  120
NRAPNGVKTG WIMHEFRLED PHMPPKEDWV LCRVFYKSRG ESSNNFIPEN LYDLHTTGDT  180
SPNLGSSPTN IEPNHHQNMI TPSFNEGRNP SSSSGLLPLH FHIYHEECNK NVVSRPSTSN  240
HGHKLVESKC EEDYGFLFDM SLDYSTGVAS YLEDVRFDHD SSSIFI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A2e-46915816166NO APICAL MERISTEM PROTEIN
1ut4_B2e-46915816166NO APICAL MERISTEM PROTEIN
1ut7_A2e-46915816166NO APICAL MERISTEM PROTEIN
1ut7_B2e-46915816166NO APICAL MERISTEM PROTEIN
4dul_A2e-46915816166NAC domain-containing protein 19
4dul_B2e-46915816166NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator that mediates auxin signaling to promote lateral root development. Activates the expression of two downstream auxin-responsive genes, DBP and AIR3. {ECO:0000269|PubMed:11114891}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by auxin.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_022874530.11e-123protein CUP-SHAPED COTYLEDON 3-like
SwissprotQ84TE64e-58NAC22_ARATH; NAC domain-containing protein 21/22
TrEMBLA0A2G9HEI91e-124A0A2G9HEI9_9LAMI; Uncharacterized protein
STRINGEOX944241e-115(Theobroma cacao)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA18822466
Publications ? help Back to Top
  1. Le Hénanff G, et al.
    Grapevine NAC1 transcription factor as a convergent node in developmental processes, abiotic stresses, and necrotrophic/biotrophic pathogen tolerance.
    J. Exp. Bot., 2013. 64(16): p. 4877-93
    [PMID:24043850]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  3. Xiao D, et al.
    SENESCENCE-SUPPRESSED PROTEIN PHOSPHATASE Directly Interacts with the Cytoplasmic Domain of SENESCENCE-ASSOCIATED RECEPTOR-LIKE KINASE and Negatively Regulates Leaf Senescence in Arabidopsis.
    Plant Physiol., 2015. 169(2): p. 1275-91
    [PMID:26304848]
  4. Huo X,Wang C,Teng Y,Liu X
    Identification of miRNAs associated with dark-induced senescence in Arabidopsis.
    BMC Plant Biol., 2015. 15: p. 266
    [PMID:26530097]
  5. Chen X, et al.
    Auxin-Independent NAC Pathway Acts in Response to Explant-Specific Wounding and Promotes Root Tip Emergence during de Novo Root Organogenesis in Arabidopsis.
    Plant Physiol., 2016. 170(4): p. 2136-45
    [PMID:26850273]
  6. Liu C,Wang B,Li Z,Peng Z,Zhang J
    TsNAC1 Is a Key Transcription Factor in Abiotic Stress Resistance and Growth.
    Plant Physiol., 2018. 176(1): p. 742-756
    [PMID:29122985]