PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ote100057290021
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Ocimeae; Ocimum
Family HSF
Protein Properties Length: 283aa    MW: 32439.3 Da    PI: 4.921
Description HSF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ote100057290021genomeOteDB-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HSF_DNA-bind30.31.1e-095188239
                                  HHHHHHHHHCTGGGTTTSEESSSSSEEEES-HHHHHHH CS
                  HSF_DNA-bind  2 Flkklyeiledeelkeliswsengnsfvvldeeefakk 39
                                  Fl+k++++++d ++++++sws+ g+sf+v+d++ f+++
  Ote100057290021|100057290021 51 FLTKTFDMVDDMSTNHIVSWSRAGHSFIVWDPHAFSTN 88
                                  9**********************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.107.5E-114587IPR011991Winged helix-turn-helix DNA-binding domain
SuperFamilySSF467851.5E-1647119IPR011991Winged helix-turn-helix DNA-binding domain
SMARTSM004152.6E-2647119IPR000232Heat shock factor (HSF)-type, DNA-binding
PfamPF004472.9E-75188IPR000232Heat shock factor (HSF)-type, DNA-binding
Gene3DG3DSA:1.10.10.101.1E-489119IPR011991Winged helix-turn-helix DNA-binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 283 aa     Download sequence    Send to blast
MERMFPVKEE YPGASSSWPE SSSQVEAAAP PEYGLAPRPM EGLHEMGPPP FLTKTFDMVD  60
DMSTNHIVSW SRAGHSFIVW DPHAFSTNGF RKIEADKWEF ANEAFVRGQK HLLKRVRRRK  120
ASVPQFAPSQ DPCVEVGRFG LDGEVDSLRR DKQVLVTELV KLRQQQQTTR AYLQQMEVRL  180
ETTERKQKQM MNFLARAMQN PEFLHQLLEA LALEMQGFGR AKWEEEPDNY KELDDGFWEE  240
LLNEGFDEDS GMNRGGGEXX XXXXXXXVSV LADRLGFLAS TPN
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator that specifically binds DNA sequence 5'-AGAAnnTTCT-3' known as heat shock promoter elements (HSE).
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011079918.11e-109heat stress transcription factor A-7a
SwissprotQ9LUH81e-76HFA6B_ARATH; Heat stress transcription factor A-6b
TrEMBLA0A2G9GNX31e-104A0A2G9GNX3_9LAMI; Heat shock transcription factor
STRINGPOPTR_0002s04900.12e-96(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA57224113