PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ote100040870191
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Ocimeae; Ocimum
Family G2-like
Protein Properties Length: 289aa    MW: 31770.4 Da    PI: 6.5135
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ote100040870191genomeOteDB-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like108.24.3e-343892155
                       G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                                  kprlrWt +LHerFv+av+qLGG++kAtPkti+++m+vkgLtl+h+kSHLQkYRl
  Ote100040870191|100040870191 38 KPRLRWTADLHERFVDAVTQLGGADKATPKTIMRTMGVKGLTLYHLKSHLQKYRL 92
                                  79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129411.6663595IPR017930Myb domain
Gene3DG3DSA:1.10.10.608.5E-333692IPR009057Homeodomain-like
SuperFamilySSF466891.09E-163792IPR009057Homeodomain-like
TIGRFAMsTIGR015574.3E-243893IPR006447Myb domain, plants
PfamPF002495.0E-84091IPR001005SANT/Myb domain
PfamPF143794.3E-26131176IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 289 aa     Download sequence    Send to blast
MYSALPLHTL AVEPDFQGSL DGTNLPGDAC LILSTDPKPR LRWTADLHER FVDAVTQLGG  60
ADKATPKTIM RTMGVKGLTL YHLKSHLQKY RLGKLASSKD LTEISKDEEW YKPFILFTIT  120
LAVQVEIDAL VTEALRVQME VQRKLHEQLE VQRHLQIRIE AQSKYLQSIL DKACKALDDE  180
AAASAGLEVA RKELSVLAIK VANDCNGVLS VPPSSHIHNE SDNDTNSIPY MPARLGECSI  240
DSGAMSNGSP ISPSTLESQA AAMKKRPRPL FSGGDGSMRP VEWMMSNFG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A1e-193894258Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B1e-193894258Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_A1e-193894157Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B1e-193894157Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C1e-193894157Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D1e-193894157Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A1e-193894258Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C1e-193894258Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D1e-193894258Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F1e-193894258Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H1e-193894258Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J1e-193894258Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator (PubMed:26586833). Acts redundantly with PHR1 as a key component of the central regulatory system controlling transcriptional responses to Pi starvation (PubMed:26586833). Binds in a sequence-specific manner to phosphate starvation-regulated promoters (PubMed:26586833). {ECO:0000269|PubMed:26586833}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Up-regulated in roots by low Pi. {ECO:0000269|PubMed:26586833}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011091432.11e-133protein PHR1-LIKE 2 isoform X2
SwissprotQ94A579e-95PHL2_ARATH; Protein PHR1-LIKE 2
TrEMBLA0A4D9BKZ21e-141A0A4D9BKZ2_SALSN; Uncharacterized protein
STRINGXP_002518104.11e-120(Ricinus communis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA37912344
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]