PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ote100035150051
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Ocimeae; Ocimum
Family bZIP
Protein Properties Length: 187aa    MW: 22174.5 Da    PI: 6.867
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ote100035150051genomeOteDB-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_146.76.7e-1571122556
                                   CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                        bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkev 56 
                                   +++rr+++NRe+ArrsR RK+  ++eL   v  L +eN++L+++l+++++  
  Ote100035150051|100035150051  71 RKQRRMISNRESARRSRMRKQRHLDELWSQVLRLRTENHSLIDKLNQISESH 122
                                   79******************************************99998865 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003386.1E-1767131IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.27769132IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1702.0E-1269124No hitNo description
SuperFamilySSF579599.14E-1371121No hitNo description
PfamPF001701.2E-1271121IPR004827Basic-leucine zipper domain
CDDcd147024.00E-1972122No hitNo description
PROSITE patternPS0003607489IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 187 aa     Download sequence    Send to blast
MIQSDFQEFN YFENLPAFHP SFRLNQTNSP PLQHTRFFPN YYTPLPNGVH EFSPNSSDEA  60
EDHQPRVIDE RKQRRMISNR ESARRSRMRK QRHLDELWSQ VLRLRTENHS LIDKLNQISE  120
SHERFVQENA RLKEEASELR QTLTEINITN SYTIFRDLDD LIPCNTAHLR AESSSNHSVT  180
TSTNLLH
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in somatic embryogenesis. Acts as positive regulator of BHLH109. {ECO:0000269|PubMed:26973252}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011077776.13e-84basic leucine zipper 43
SwissprotQ9FMC21e-35BZP43_ARATH; Basic leucine zipper 43
TrEMBLA0A2G9I8251e-74A0A2G9I825_9LAMI; Uncharacterized protein
STRINGXP_009774323.16e-65(Nicotiana sylvestris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA9472492
Publications ? help Back to Top
  1. Nowak K,Gaj MD
    Stress-related function of bHLH109 in somatic embryo induction in Arabidopsis.
    J. Plant Physiol., 2016. 193: p. 119-26
    [PMID:26973252]
  2. Ezer D, et al.
    The G-Box Transcriptional Regulatory Code in Arabidopsis.
    Plant Physiol., 2017. 175(2): p. 628-640
    [PMID:28864470]